DUF1315 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1315 - Protein of unknown function (DUF1315)

PFAM:	PF07023	Sequences: EQLIASMTPEIYERLKTAVELGKWPDGRALTPEQRELCLQAVIAYEARHLPEEERVGYIDRKSKAGEELKDEFSEEQEDEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	81 (71)
Sequences:	1109 (665)
Seq/√Len:	78.9
META:	0.676

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
46_E	50_L	4.095	1.00
22_G	35_R	3.067	1.00
14_R	25_P	2.718	1.00
7_M	12_Y	2.477	1.00
40_Q	44_A	2.439	1.00
46_E	56_V	2.412	1.00
17_T	20_E	2.326	1.00
17_T	21_L	2.294	1.00
19_V	35_R	2.121	1.00
5_A	48_R	2.073	1.00
45_Y	49_H	1.958	1.00
32_P	36_E	1.937	1.00
52_E	55_R	1.643	1.00
19_V	38_C	1.638	1.00
14_R	17_T	1.607	1.00
12_Y	45_Y	1.517	0.99
50_L	53_E	1.437	0.99
30_L	38_C	1.429	0.99
59_I	64_K	1.395	0.99
59_I	62_K	1.320	0.98
33_E	37_L	1.290	0.98
19_V	39_L	1.285	0.98
16_K	46_E	1.266	0.98
23_K	29_A	1.247	0.97
2_Q	5_A	1.238	0.97
51_P	54_E	1.228	0.97
3_L	6_S	1.166	0.96
46_E	55_R	1.159	0.96
15_L	19_V	1.130	0.95
38_C	42_V	1.128	0.95
70_K	73_F	1.106	0.95
10_E	14_R	1.090	0.94
33_E	57_G	1.037	0.93
45_Y	50_L	0.951	0.89
41_A	59_I	0.908	0.87
13_E	16_K	0.904	0.87
71_D	74_S	0.892	0.86
59_I	65_A	0.865	0.84
37_L	41_A	0.835	0.82
30_L	35_R	0.819	0.81
11_I	25_P	0.809	0.80
12_Y	24_W	0.807	0.80
68_E	72_E	0.803	0.80
6_S	39_L	0.802	0.79
19_V	42_V	0.792	0.79
39_L	69_L	0.789	0.78
18_A	38_C	0.784	0.78
33_E	36_E	0.771	0.77
7_M	37_L	0.769	0.77
63_S	72_E	0.762	0.76
9_P	13_E	0.737	0.73
43_I	55_R	0.729	0.73
41_A	58_Y	0.729	0.73
36_E	40_Q	0.724	0.72
21_L	29_A	0.722	0.72
68_E	71_D	0.710	0.71
26_D	57_G	0.709	0.71
4_I	11_I	0.703	0.70
4_I	44_A	0.699	0.69
43_I	46_E	0.694	0.69
44_A	58_Y	0.691	0.69
7_M	40_Q	0.690	0.68
25_P	62_K	0.689	0.68
45_Y	74_S	0.689	0.68
61_R	64_K	0.685	0.68
55_R	58_Y	0.681	0.67
43_I	63_S	0.680	0.67
69_L	72_E	0.669	0.66
32_P	49_H	0.667	0.66
59_I	63_S	0.667	0.66
57_G	64_K	0.657	0.65
47_A	55_R	0.648	0.64
16_K	20_E	0.645	0.63
23_K	68_E	0.643	0.63
30_L	43_I	0.634	0.62
55_R	69_L	0.632	0.62
7_M	11_I	0.629	0.61
7_M	41_A	0.624	0.61
50_L	55_R	0.623	0.61
40_Q	43_I	0.621	0.60
35_R	42_V	0.616	0.60
7_M	16_K	0.616	0.60
70_K	74_S	0.612	0.59
21_L	71_D	0.604	0.58
15_L	45_Y	0.603	0.58
11_I	44_A	0.601	0.58
14_R	21_L	0.585	0.56
31_T	42_V	0.576	0.55
12_Y	16_K	0.572	0.54
25_P	28_R	0.567	0.54
26_D	32_P	0.561	0.53
21_L	25_P	0.558	0.52
34_Q	42_V	0.558	0.52
29_A	35_R	0.553	0.52
3_L	44_A	0.545	0.51
18_A	34_Q	0.526	0.48
51_P	70_K	0.525	0.48
30_L	42_V	0.524	0.48
62_K	65_A	0.516	0.47
4_I	48_R	0.508	0.46
68_E	73_F	0.504	0.45
18_A	25_P	0.504	0.45
10_E	23_K	0.504	0.45
38_C	46_E	0.503	0.45
14_R	43_I	0.501	0.45
6_S	11_I	0.500	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ek5A	4	0.9259	40.9	0.889	Contact Map
3bwgA	2	0.8765	35.3	0.893	Contact Map
4h0eA	2	0.8642	33.6	0.894	Contact Map
3sxyA	2	0.9012	32.4	0.895	Contact Map
2di3A	2	0.9506	27.9	0.899	Contact Map
3neuA	2	0.963	26.2	0.9	Contact Map
3ic7A	2	0.9259	24.6	0.901	Contact Map
1zbdB	1	0.5926	23.9	0.902	Contact Map
4p9fA	1	0.9136	23.8	0.902	Contact Map
2hs5A	1	0.9136	23.8	0.902	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.