Rab5ip - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Rab5ip - Rab5-interacting protein (Rab5ip)

PFAM:	PF07019	Sequences: VLYWIRQLTALLAGVAAGILGLTGLLGFLFYLLSSLLVSLLYYALKAGFKPEKYFGGPWSELLTEGLFGGLMTFVLFWTLFY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	82 (80)
Sequences:	988 (755)
Seq/√Len:	84.5
META:	0.459

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_F	71_L	4.325	1.00
75_V	79_T	3.613	1.00
47_A	51_P	2.545	1.00
17_A	30_F	2.208	1.00
13_A	34_S	2.072	1.00
17_A	74_F	2.048	1.00
73_T	77_F	2.020	1.00
33_L	37_L	1.879	1.00
11_L	77_F	1.796	1.00
50_K	53_K	1.746	1.00
43_Y	63_L	1.705	1.00
31_Y	69_G	1.682	1.00
3_Y	7_Q	1.582	1.00
32_L	67_L	1.576	1.00
9_T	38_V	1.561	1.00
23_T	82_Y	1.508	0.99
77_F	81_F	1.505	0.99
68_F	71_L	1.495	0.99
12_L	49_F	1.485	0.99
50_K	54_Y	1.433	0.99
17_A	80_L	1.395	0.99
17_A	22_L	1.311	0.99
31_Y	41_L	1.296	0.98
15_V	19_I	1.280	0.98
78_W	82_Y	1.279	0.98
32_L	60_S	1.236	0.98
40_L	44_A	1.231	0.98
50_K	56_G	1.210	0.98
7_Q	19_I	1.192	0.97
6_R	28_F	1.136	0.96
26_L	29_L	1.124	0.96
74_F	78_W	1.120	0.96
6_R	24_G	1.117	0.96
37_L	41_L	1.048	0.94
71_L	75_V	1.044	0.94
31_Y	70_G	1.016	0.93
21_G	76_L	1.000	0.93
5_I	49_F	0.989	0.92
35_S	68_F	0.982	0.92
32_L	53_K	0.977	0.92
19_I	81_F	0.964	0.91
65_E	70_G	0.951	0.91
8_L	77_F	0.936	0.90
44_A	49_F	0.935	0.90
46_K	70_G	0.927	0.90
10_A	31_Y	0.920	0.89
47_A	53_K	0.918	0.89
9_T	41_L	0.918	0.89
7_Q	76_L	0.917	0.89
2_L	73_T	0.911	0.89
69_G	73_T	0.903	0.89
23_T	77_F	0.882	0.87
56_G	64_T	0.875	0.87
18_G	36_L	0.852	0.85
68_F	75_V	0.844	0.85
50_K	74_F	0.842	0.85
25_L	36_L	0.835	0.84
9_T	12_L	0.834	0.84
27_G	30_F	0.821	0.83
7_Q	62_L	0.815	0.83
30_F	74_F	0.815	0.83
37_L	52_E	0.808	0.82
20_L	27_G	0.808	0.82
4_W	12_L	0.805	0.82
73_T	79_T	0.800	0.82
34_S	38_V	0.794	0.81
41_L	70_G	0.787	0.81
35_S	67_L	0.782	0.80
32_L	35_S	0.778	0.80
26_L	33_L	0.774	0.79
30_F	65_E	0.763	0.78
15_V	81_F	0.748	0.77
36_L	42_Y	0.748	0.77
6_R	55_F	0.742	0.77
10_A	70_G	0.728	0.75
28_F	40_L	0.726	0.75
22_L	76_L	0.724	0.75
19_I	27_G	0.711	0.73
35_S	72_M	0.707	0.73
76_L	79_T	0.702	0.73
6_R	47_A	0.699	0.72
15_V	62_L	0.699	0.72
18_G	21_G	0.692	0.71
45_L	75_V	0.687	0.71
36_L	40_L	0.686	0.71
13_A	23_T	0.686	0.71
38_V	52_E	0.685	0.71
75_V	80_L	0.685	0.71
74_F	80_L	0.673	0.69
27_G	54_Y	0.673	0.69
32_L	50_K	0.672	0.69
25_L	82_Y	0.669	0.69
51_P	62_L	0.649	0.67
22_L	27_G	0.632	0.64
10_A	73_T	0.629	0.64
33_L	60_S	0.628	0.64
13_A	55_F	0.625	0.64
15_V	71_L	0.618	0.63
57_G	63_L	0.616	0.63
39_S	63_L	0.611	0.62
32_L	42_Y	0.606	0.61
6_R	72_M	0.598	0.60
10_A	45_L	0.588	0.59
8_L	81_F	0.581	0.58
31_Y	38_V	0.573	0.57
19_I	54_Y	0.568	0.56
57_G	69_G	0.563	0.56
23_T	79_T	0.558	0.55
17_A	21_G	0.552	0.54
19_I	42_Y	0.550	0.54
13_A	73_T	0.544	0.53
15_V	51_P	0.544	0.53
14_G	73_T	0.534	0.52
8_L	35_S	0.534	0.52
40_L	54_Y	0.526	0.51
5_I	43_Y	0.525	0.51
55_F	60_S	0.514	0.49
17_A	55_F	0.511	0.49
56_G	60_S	0.502	0.48
62_L	68_F	0.500	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3dh4A	3	0.9756	2.4	0.902	Contact Map
2l2tA	2	0.5244	2	0.906	Contact Map
3tx3A	2	0.6341	1.9	0.908	Contact Map
4c7rA	3	0.9878	1.7	0.91	Contact Map
2m20A	2	0.6951	1.5	0.914	Contact Map
4czbA	2	0.9878	1.4	0.915	Contact Map
4dw1A	3	0.2195	1.3	0.916	Contact Map
4p6vB	1	0.622	1.3	0.917	Contact Map
4bwzA	2	0.9756	1.2	0.919	Contact Map
1rh5A	1	0.622	1.1	0.919	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.