DUF1304 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1304 - Protein of unknown function (DUF1304)

PFAM:	PF06993	Sequences: ALVALLHVYILVLEMFLWTTPRGRKTFGLTPEFAAATTKVLAANQGLYNGFLAAGLIWGLLLGDPAWGFAVKLFFLGCVIVAGIYGAATASRRILFVQALPALLALVLLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	110 (107)
Sequences:	8170 (4768)
Seq/√Len:	460.9
META:	0.848

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
12_V	17_L	2.974	1.00
19_T	35_A	2.615	1.00
31_P	35_A	2.535	1.00
33_F	36_A	2.368	1.00
19_T	39_K	2.291	1.00
59_G	72_K	2.262	1.00
83_G	99_A	2.184	1.00
11_L	50_G	2.142	1.00
43_A	85_Y	2.012	1.00
74_F	78_C	1.993	1.00
80_I	99_A	1.976	1.00
73_L	106_L	1.976	1.00
55_G	74_F	1.786	1.00
93_R	97_V	1.766	1.00
22_R	26_T	1.655	1.00
30_T	34_A	1.638	1.00
29_L	33_F	1.636	1.00
32_E	36_A	1.616	1.00
6_L	10_I	1.615	1.00
69_F	72_K	1.563	1.00
67_W	70_A	1.439	1.00
33_F	37_T	1.385	1.00
58_W	71_V	1.384	1.00
8_V	57_I	1.378	1.00
11_L	15_M	1.374	1.00
4_A	57_I	1.362	1.00
80_I	103_L	1.349	1.00
64_D	70_A	1.338	1.00
24_R	29_L	1.332	1.00
55_G	75_F	1.306	1.00
104_L	108_L	1.294	1.00
13_L	23_G	1.292	1.00
76_L	105_A	1.281	1.00
24_R	31_P	1.277	1.00
22_R	25_K	1.263	1.00
51_F	78_C	1.261	1.00
15_M	85_Y	1.257	1.00
18_W	41_L	1.243	1.00
62_L	67_W	1.228	1.00
30_T	33_F	1.220	1.00
3_V	79_V	1.197	1.00
69_F	73_L	1.190	1.00
20_T	23_G	1.181	1.00
8_V	53_A	1.173	1.00
17_L	20_T	1.165	1.00
24_R	34_A	1.161	1.00
73_L	77_G	1.156	1.00
59_G	71_V	1.141	1.00
11_L	16_F	1.139	1.00
15_M	47_L	1.132	1.00
62_L	71_V	1.117	1.00
62_L	70_A	1.110	1.00
56_L	75_F	1.100	1.00
31_P	34_A	1.094	1.00
72_K	109_L	1.075	1.00
47_L	85_Y	1.065	1.00
87_A	95_L	1.063	1.00
19_T	24_R	1.058	1.00
73_L	109_L	1.051	1.00
95_L	103_L	1.043	1.00
12_V	16_F	1.038	1.00
9_Y	26_T	1.013	1.00
59_G	68_G	1.003	1.00
34_A	37_T	0.993	1.00
58_W	70_A	0.989	1.00
58_W	75_F	0.971	1.00
60_L	72_K	0.968	1.00
13_L	26_T	0.960	1.00
20_T	24_R	0.951	1.00
84_I	88_A	0.941	1.00
51_F	82_A	0.933	1.00
95_L	99_A	0.927	1.00
80_I	106_L	0.920	1.00
29_L	34_A	0.918	1.00
23_G	26_T	0.915	1.00
11_L	53_A	0.893	1.00
43_A	88_A	0.867	1.00
30_T	36_A	0.865	1.00
67_W	71_V	0.845	1.00
19_T	36_A	0.843	1.00
57_I	61_L	0.842	1.00
47_L	51_F	0.839	1.00
9_Y	22_R	0.820	1.00
41_L	90_A	0.814	1.00
99_A	103_L	0.811	1.00
10_I	97_V	0.809	1.00
6_L	11_L	0.800	1.00
39_K	43_A	0.793	1.00
77_G	81_V	0.789	1.00
17_L	23_G	0.784	1.00
40_V	90_A	0.780	1.00
64_D	67_W	0.775	1.00
17_L	22_R	0.771	1.00
96_F	100_L	0.759	1.00
24_R	32_E	0.752	1.00
63_G	68_G	0.752	1.00
66_A	70_A	0.747	1.00
30_T	37_T	0.747	1.00
56_L	76_L	0.742	1.00
18_W	42_A	0.733	1.00
58_W	62_L	0.728	1.00
65_P	69_F	0.720	1.00
65_P	70_A	0.705	1.00
47_L	50_G	0.700	1.00
62_L	65_P	0.692	1.00
6_L	9_Y	0.692	1.00
18_W	37_T	0.691	1.00
92_R	96_F	0.690	1.00
99_A	102_A	0.687	1.00
32_E	35_A	0.681	1.00
53_A	57_I	0.680	1.00
56_L	79_V	0.679	1.00
29_L	37_T	0.678	1.00
86_G	94_I	0.677	1.00
79_V	102_A	0.675	1.00
3_V	6_L	0.669	1.00
68_G	72_K	0.665	1.00
29_L	35_A	0.664	1.00
29_L	36_A	0.640	1.00
19_T	34_A	0.636	0.99
3_V	80_I	0.636	0.99
62_L	68_G	0.629	0.99
40_V	89_T	0.624	0.99
44_N	98_Q	0.623	0.99
24_R	35_A	0.619	0.99
92_R	95_L	0.619	0.99
2_L	101_P	0.617	0.99
37_T	41_L	0.616	0.99
30_T	35_A	0.613	0.99
37_T	42_A	0.606	0.99
36_A	40_V	0.603	0.99
29_L	40_V	0.593	0.99
90_A	94_I	0.593	0.99
78_C	82_A	0.589	0.99
11_L	47_L	0.589	0.99
21_P	24_R	0.585	0.99
44_N	48_Y	0.583	0.99
2_L	6_L	0.582	0.99
41_L	45_Q	0.574	0.99
87_A	96_F	0.573	0.99
86_G	95_L	0.571	0.99
56_L	72_K	0.569	0.99
71_V	75_F	0.560	0.99
21_P	31_P	0.553	0.99
44_N	89_T	0.548	0.99
3_V	76_L	0.547	0.98
66_A	69_F	0.545	0.98
43_A	47_L	0.533	0.98
14_E	44_N	0.532	0.98
28_G	34_A	0.529	0.98
44_N	82_A	0.528	0.98
5_L	57_I	0.522	0.98
77_G	106_L	0.519	0.98
42_A	45_Q	0.516	0.98
12_V	22_R	0.512	0.98
43_A	89_T	0.503	0.97
58_W	77_G	0.502	0.97
63_G	67_W	0.501	0.97
28_G	91_S	0.500	0.97
8_V	12_V	0.500	0.97

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4n7wA	2	0.8	5.9	0.923	Contact Map
4gd3A	2	0.1727	4.1	0.928	Contact Map
4jc95	3	0.2182	3.5	0.93	Contact Map
3wmmA	3	0.2909	2.2	0.938	Contact Map
1khyA	1	0.3636	1.7	0.941	Contact Map
2y1qA	1	0.4091	1.5	0.943	Contact Map
1lghA	5	0.2636	1.5	0.944	Contact Map
1xrdA	1	0.2727	1.5	0.944	Contact Map
3j01B	1	0.4091	1.4	0.944	Contact Map
2zf9A	1	0.5364	1.4	0.944	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.