HET - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HET - Heterokaryon incompatibility protein (HET)

PFAM:	PF06985	Sequences: YEALSYVWGDPSNTETILVNGPPLSLPKNLQDALRVLRRLGIRYLWIDALCINQDDDEEKSHQVALMGDIYSNAYLVIVWLGAEDSDSGLLALRLLRRLAPLSLELLPDSLRLDSPLLPPLLSDLWDALRDLLSRPWFTRAWVLQE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	146 (144)
Sequences:	9810 (9169)
Seq/√Len:	764.1
META:	0.428

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
60_K	64_V	3.824	1.00
2_E	76_L	3.371	1.00
79_V	137_W	3.092	1.00
53_N	56_D	3.045	1.00
74_A	77_V	2.945	1.00
31_Q	35_R	2.728	1.00
2_E	43_R	2.715	1.00
3_A	77_V	2.530	1.00
30_L	47_I	2.489	1.00
57_D	61_S	2.394	1.00
66_L	69_D	2.387	1.00
137_W	143_V	2.347	1.00
2_E	42_I	2.298	1.00
63_Q	66_L	2.205	1.00
4_L	33_A	2.202	1.00
7_V	136_P	2.182	1.00
57_D	60_K	2.165	1.00
3_A	74_A	2.159	1.00
53_N	59_E	2.055	1.00
42_I	75_Y	2.026	1.00
6_Y	49_A	2.013	1.00
15_E	31_Q	1.972	1.00
28_K	32_D	1.865	1.00
32_D	83_A	1.785	1.00
6_Y	30_L	1.768	1.00
33_A	37_L	1.734	1.00
69_D	73_N	1.656	1.00
85_D	88_S	1.641	1.00
16_T	25_S	1.500	1.00
1_Y	73_N	1.437	1.00
2_E	78_I	1.427	1.00
2_E	37_L	1.412	1.00
15_E	28_K	1.390	1.00
136_P	139_T	1.382	1.00
24_L	50_L	1.378	1.00
68_G	72_S	1.352	1.00
84_E	88_S	1.321	1.00
58_E	61_S	1.317	1.00
132_L	135_R	1.287	1.00
36_V	83_A	1.264	1.00
30_L	33_A	1.239	1.00
19_V	24_L	1.236	1.00
67_M	71_Y	1.232	1.00
83_A	88_S	1.204	1.00
36_V	90_L	1.174	1.00
4_L	47_I	1.168	1.00
61_S	64_V	1.165	1.00
17_I	21_G	1.143	1.00
135_R	138_F	1.140	1.00
59_E	63_Q	1.127	1.00
77_V	143_V	1.126	1.00
28_K	31_Q	1.109	1.00
128_A	132_L	1.108	1.00
62_H	66_L	1.102	1.00
32_D	36_V	1.093	1.00
3_A	70_I	1.091	1.00
79_V	143_V	1.089	1.00
2_E	75_Y	1.085	1.00
23_P	31_Q	1.083	1.00
132_L	138_F	1.073	1.00
7_V	137_W	1.072	1.00
63_Q	70_I	1.064	1.00
17_I	20_N	1.046	1.00
16_T	20_N	1.042	1.00
16_T	23_P	1.041	1.00
33_A	45_L	1.039	1.00
6_Y	86_S	1.039	1.00
61_S	65_A	1.037	1.00
8_W	54_Q	1.017	1.00
36_V	80_W	1.015	1.00
13_N	21_G	0.996	1.00
14_T	17_I	0.979	1.00
7_V	143_V	0.966	1.00
81_L	138_F	0.958	1.00
35_R	39_R	0.946	1.00
84_E	90_L	0.928	1.00
141_A	144_L	0.926	1.00
60_K	65_A	0.915	1.00
26_L	31_Q	0.912	1.00
56_D	59_E	0.909	1.00
30_L	80_W	0.907	1.00
29_N	89_G	0.902	1.00
52_I	63_Q	0.902	1.00
119_P	122_L	0.901	1.00
36_V	78_I	0.899	1.00
13_N	28_K	0.898	1.00
37_L	42_I	0.896	1.00
38_R	43_R	0.892	1.00
6_Y	29_N	0.888	1.00
26_L	34_L	0.885	1.00
52_I	60_K	0.884	1.00
40_L	43_R	0.875	1.00
66_L	70_I	0.870	1.00
37_L	45_L	0.866	1.00
81_L	135_R	0.864	1.00
54_Q	60_K	0.854	1.00
90_L	94_R	0.849	1.00
18_L	23_P	0.844	1.00
27_P	30_L	0.840	1.00
82_G	135_R	0.837	1.00
81_L	137_W	0.828	1.00
88_S	135_R	0.820	1.00
71_Y	145_Q	0.800	1.00
81_L	132_L	0.791	1.00
4_L	30_L	0.790	1.00
138_F	144_L	0.786	1.00
67_M	140_R	0.780	1.00
13_N	16_T	0.773	1.00
27_P	49_A	0.765	1.00
2_E	45_L	0.757	1.00
4_L	80_W	0.753	1.00
14_T	25_S	0.745	1.00
91_L	125_L	0.742	1.00
58_E	62_H	0.736	1.00
42_I	76_L	0.735	1.00
37_L	78_I	0.734	1.00
138_F	143_V	0.733	1.00
102_L	105_E	0.729	1.00
29_N	49_A	0.721	1.00
101_P	104_L	0.721	1.00
59_E	62_H	0.718	1.00
16_T	19_V	0.717	1.00
25_S	28_K	0.715	1.00
94_R	97_R	0.714	1.00
69_D	72_S	0.712	1.00
108_P	111_L	0.709	1.00
8_W	27_P	0.706	1.00
118_L	122_L	0.705	1.00
19_V	138_F	0.704	1.00
119_P	123_S	0.703	1.00
129_L	133_L	0.702	1.00
109_D	113_L	0.702	1.00
4_L	37_L	0.701	1.00
84_E	135_R	0.695	1.00
18_L	21_G	0.693	1.00
76_L	79_V	0.693	1.00
26_L	50_L	0.688	1.00
92_A	95_L	0.686	1.00
90_L	93_L	0.683	1.00
15_E	18_L	0.682	1.00
13_N	27_P	0.676	1.00
62_H	65_A	0.669	1.00
91_L	128_A	0.668	1.00
122_L	125_L	0.667	1.00
39_R	43_R	0.664	1.00
80_W	83_A	0.660	1.00
27_P	86_S	0.660	1.00
45_L	78_I	0.657	1.00
10_D	13_N	0.657	1.00
106_L	109_D	0.657	1.00
30_L	50_L	0.656	1.00
95_L	98_R	0.655	1.00
100_A	104_L	0.654	1.00
11_P	27_P	0.653	1.00
14_T	27_P	0.652	1.00
113_L	117_L	0.637	1.00
29_N	33_A	0.636	1.00
26_L	29_N	0.633	1.00
123_S	126_W	0.632	1.00
1_Y	70_I	0.623	1.00
107_L	111_L	0.622	1.00
50_L	53_N	0.615	1.00
130_R	134_S	0.615	1.00
7_V	60_K	0.612	1.00
36_V	40_L	0.612	1.00
40_L	76_L	0.611	1.00
7_V	141_A	0.611	1.00
13_N	18_L	0.610	1.00
107_L	110_S	0.605	1.00
14_T	18_L	0.602	1.00
7_V	29_N	0.601	1.00
26_L	30_L	0.596	1.00
33_A	47_I	0.596	1.00
41_G	44_Y	0.594	1.00
29_N	80_W	0.591	1.00
8_W	67_M	0.589	1.00
71_Y	77_V	0.585	1.00
22_P	25_S	0.585	1.00
6_Y	47_I	0.584	1.00
33_A	80_W	0.581	1.00
96_L	129_L	0.579	1.00
91_L	95_L	0.576	1.00
56_D	61_S	0.570	1.00
13_N	20_N	0.570	1.00
32_D	80_W	0.569	1.00
70_I	77_V	0.568	1.00
121_L	125_L	0.565	1.00
30_L	49_A	0.565	1.00
29_N	32_D	0.564	1.00
32_D	35_R	0.563	1.00
109_D	114_D	0.561	1.00
40_L	44_Y	0.554	1.00
17_I	50_L	0.549	1.00
7_V	10_D	0.544	1.00
48_D	54_Q	0.542	1.00
112_R	118_L	0.542	1.00
34_L	37_L	0.542	1.00
100_A	103_S	0.540	1.00
43_R	78_I	0.534	1.00
24_L	35_R	0.533	1.00
120_P	126_W	0.532	1.00
91_L	94_R	0.531	1.00
85_D	131_D	0.529	1.00
15_E	19_V	0.525	1.00
10_D	14_T	0.524	1.00
108_P	112_R	0.524	1.00
95_L	99_L	0.523	1.00
109_D	112_R	0.521	1.00
93_L	97_R	0.518	1.00
120_P	128_A	0.517	1.00
99_L	129_L	0.513	1.00
2_E	39_R	0.509	1.00
142_W	146_E	0.503	1.00
124_D	128_A	0.502	1.00
64_V	68_G	0.500	1.00
49_A	63_Q	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ltrD	5	0.5	3.5	0.934	Contact Map
4x9cA	3	0.3014	2.2	0.941	Contact Map
2jexA	1	0.6438	2	0.943	Contact Map
2nnuA	1	0.6644	1.7	0.945	Contact Map
2kigA	1	0.3904	1.5	0.946	Contact Map
1tueB	1	0.6918	1.4	0.947	Contact Map
4m1uB	3	0.2534	1.4	0.947	Contact Map
3kk4A	2	0.5548	1.3	0.948	Contact Map
4b9jA	1	0.2671	1.3	0.949	Contact Map
4n7bA	1	0.8904	1.2	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.