Mo-nitro_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Mo-nitro_C - Mo-dependent nitrogenase C-terminus

PFAM:	PF06967	Sequences: LLQPLRQWLDGIEIHDPKLAHFLCKLIPAQCPFERDIKLFGRKLFHIPPLCKLNPLYEQLVGLRFRALCYLADECGEDISPYC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	83 (82)
Sequences:	755 (386)
Seq/√Len:	42.6
META:	0.57

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_D	46_H	5.117	1.00
10_D	59_Q	4.167	1.00
34_E	61_V	3.522	1.00
10_D	66_R	3.424	1.00
38_K	43_K	3.184	1.00
23_L	27_I	2.996	1.00
34_E	46_H	2.956	1.00
10_D	62_G	2.665	1.00
21_H	77_E	2.265	1.00
21_H	82_Y	2.160	1.00
24_C	79_I	2.115	0.99
49_P	52_K	1.785	0.98
5_L	56_L	1.666	0.97
6_R	59_Q	1.423	0.93
29_A	83_C	1.362	0.91
58_E	62_G	1.326	0.90
29_A	68_L	1.279	0.88
24_C	80_S	1.259	0.87
23_L	60_L	1.230	0.86
6_R	43_K	1.228	0.86
34_E	50_L	1.212	0.85
25_K	73_D	1.190	0.84
78_D	82_Y	1.128	0.81
30_Q	69_C	1.068	0.77
24_C	72_A	1.053	0.76
67_A	70_Y	1.050	0.76
27_I	60_L	1.021	0.74
25_K	39_L	1.016	0.73
69_C	83_C	1.010	0.73
18_K	22_F	1.002	0.72
77_E	82_Y	0.970	0.70
15_H	42_R	0.963	0.69
23_L	72_A	0.962	0.69
73_D	76_G	0.952	0.68
30_Q	49_P	0.938	0.67
38_K	41_G	0.927	0.66
7_Q	29_A	0.918	0.66
14_I	67_A	0.914	0.65
2_L	6_R	0.909	0.65
50_L	53_L	0.908	0.65
67_A	80_S	0.903	0.64
17_P	42_R	0.903	0.64
12_I	56_L	0.900	0.64
24_C	70_Y	0.866	0.61
3_Q	7_Q	0.864	0.61
49_P	53_L	0.857	0.60
19_L	58_E	0.851	0.60
40_F	43_K	0.851	0.60
37_I	49_P	0.843	0.59
62_G	66_R	0.838	0.58
78_D	83_C	0.834	0.58
23_L	63_L	0.813	0.56
4_P	56_L	0.804	0.55
53_L	70_Y	0.797	0.55
41_G	46_H	0.796	0.55
22_F	26_L	0.792	0.54
9_L	23_L	0.775	0.53
24_C	45_F	0.773	0.52
9_L	81_P	0.773	0.52
9_L	60_L	0.772	0.52
50_L	58_E	0.768	0.52
69_C	72_A	0.753	0.51
21_H	24_C	0.750	0.50
50_L	56_L	0.739	0.49
35_R	47_I	0.736	0.49
16_D	67_A	0.729	0.48
29_A	76_G	0.724	0.48
38_K	45_F	0.724	0.48
17_P	77_E	0.718	0.47
53_L	61_V	0.714	0.47
22_F	60_L	0.713	0.47
52_K	58_E	0.708	0.46
10_D	60_L	0.707	0.46
15_H	19_L	0.703	0.46
53_L	67_A	0.699	0.45
18_K	40_F	0.697	0.45
7_Q	42_R	0.691	0.45
19_L	39_L	0.689	0.44
36_D	41_G	0.686	0.44
69_C	75_C	0.680	0.44
36_D	45_F	0.678	0.43
35_R	43_K	0.674	0.43
31_C	64_R	0.671	0.43
7_Q	70_Y	0.667	0.42
13_E	82_Y	0.656	0.41
27_I	57_Y	0.655	0.41
28_P	31_C	0.651	0.41
25_K	62_G	0.651	0.41
20_A	33_F	0.642	0.40
39_L	69_C	0.641	0.40
8_W	12_I	0.627	0.39
24_C	67_A	0.626	0.39
33_F	57_Y	0.617	0.38
9_L	30_Q	0.613	0.38
69_C	81_P	0.609	0.37
17_P	81_P	0.600	0.36
28_P	48_P	0.594	0.36
32_P	47_I	0.584	0.35
65_F	69_C	0.579	0.35
17_P	80_S	0.577	0.34
25_K	81_P	0.572	0.34
65_F	77_E	0.570	0.34
51_C	54_N	0.553	0.32
25_K	38_K	0.553	0.32
15_H	23_L	0.550	0.32
47_I	52_K	0.545	0.32
72_A	83_C	0.544	0.32
48_P	51_C	0.543	0.32
19_L	23_L	0.543	0.32
26_L	62_G	0.534	0.31
2_L	56_L	0.532	0.31
70_Y	75_C	0.530	0.30
14_I	79_I	0.525	0.30
31_C	51_C	0.525	0.30
37_I	45_F	0.521	0.30
37_I	62_G	0.517	0.29
19_L	70_Y	0.516	0.29
66_R	83_C	0.515	0.29
5_L	52_K	0.514	0.29
52_K	65_F	0.508	0.29
22_F	43_K	0.505	0.29
69_C	80_S	0.502	0.28
27_I	56_L	0.500	0.28

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4xfjA	4	0.9759	22.3	0.93	Contact Map
1korA	4	0.8795	12.3	0.938	Contact Map
4hsuA	1	0.9036	6.7	0.944	Contact Map
3agtA	1	0.3494	5.8	0.946	Contact Map
3j8eG	3	0.8193	5.6	0.947	Contact Map
2lvfA	1	0.4819	4.6	0.949	Contact Map
1k92A	4	0.9639	4.4	0.949	Contact Map
2nz2A	4	0.988	4.2	0.95	Contact Map
3wynA	1	0.3976	4.1	0.95	Contact Map
1jfrA	1	0.4217	4	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.