DUF1292 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1292 - Protein of unknown function (DUF1292)

PFAM:	PF06949	Sequences: EDGNEVEFEVLDTFEVEGKEYVALTDNEEDEDEDDEEVYILRYVEEDEDGEEELEPIEDDEELEAVAEAFEELLD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	75 (73)
Sequences:	9098 (6872)
Seq/√Len:	804.4
META:	0.819

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_K	42_R	3.649	1.00
15_E	20_E	2.759	1.00
24_L	41_L	2.423	1.00
10_V	13_T	2.409	1.00
69_A	72_E	2.332	1.00
16_V	65_A	2.278	1.00
12_D	73_L	2.139	1.00
42_R	62_E	2.025	1.00
63_L	67_A	1.976	1.00
42_R	55_E	1.922	1.00
14_F	66_V	1.718	1.00
17_E	65_A	1.618	1.00
44_V	55_E	1.615	1.00
23_A	40_I	1.609	1.00
62_E	66_V	1.558	1.00
67_A	71_E	1.528	1.00
16_V	69_A	1.522	1.00
21_Y	62_E	1.474	1.00
13_T	20_E	1.418	1.00
8_F	24_L	1.412	1.00
14_F	69_A	1.395	1.00
47_D	50_G	1.340	1.00
23_A	70_F	1.279	1.00
10_V	22_V	1.226	1.00
13_T	22_V	1.213	1.00
40_I	66_V	1.206	1.00
68_E	71_E	1.179	1.00
43_Y	52_E	1.166	1.00
69_A	73_L	1.163	1.00
23_A	38_V	1.161	1.00
19_K	62_E	1.072	1.00
70_F	74_L	1.065	1.00
25_T	28_E	1.040	1.00
64_E	68_E	1.036	1.00
22_V	54_L	0.997	1.00
11_L	70_F	0.979	1.00
33_E	36_E	0.979	1.00
16_V	62_E	0.967	1.00
48_E	53_E	0.935	1.00
23_A	66_V	0.930	1.00
68_E	72_E	0.917	1.00
59_D	62_E	0.915	1.00
57_I	62_E	0.911	1.00
61_E	64_E	0.902	1.00
14_F	23_A	0.898	1.00
46_E	52_E	0.895	1.00
47_D	53_E	0.892	1.00
22_V	43_Y	0.881	1.00
39_Y	56_P	0.866	1.00
32_D	35_D	0.864	1.00
13_T	43_Y	0.846	1.00
46_E	50_G	0.836	1.00
61_E	65_A	0.811	1.00
57_I	63_L	0.808	1.00
20_E	43_Y	0.799	1.00
44_V	53_E	0.796	1.00
64_E	67_A	0.795	1.00
60_D	63_L	0.787	1.00
41_L	54_L	0.777	1.00
52_E	55_E	0.772	1.00
16_V	66_V	0.772	1.00
60_D	64_E	0.767	1.00
10_V	24_L	0.766	1.00
62_E	65_A	0.753	1.00
47_D	51_E	0.747	1.00
15_E	18_G	0.746	1.00
27_N	32_D	0.740	1.00
11_L	38_V	0.726	1.00
38_V	70_F	0.726	1.00
46_E	49_D	0.724	1.00
8_F	39_Y	0.722	1.00
32_D	36_E	0.719	1.00
26_D	29_E	0.694	1.00
22_V	41_L	0.684	1.00
71_E	74_L	0.683	1.00
24_L	39_Y	0.683	1.00
28_E	31_E	0.682	1.00
65_A	69_A	0.682	1.00
27_N	30_D	0.648	1.00
45_E	52_E	0.647	1.00
23_A	71_E	0.641	1.00
70_F	73_L	0.623	1.00
31_E	36_E	0.622	1.00
30_D	33_E	0.618	1.00
55_E	58_E	0.616	1.00
26_D	30_D	0.614	1.00
65_A	68_E	0.611	1.00
27_N	33_E	0.603	1.00
38_V	74_L	0.602	1.00
29_E	33_E	0.597	1.00
16_V	19_K	0.597	1.00
14_F	70_F	0.580	1.00
27_N	31_E	0.577	1.00
9_E	12_D	0.574	1.00
12_D	16_V	0.571	1.00
28_E	32_D	0.560	1.00
38_V	67_A	0.558	1.00
31_E	35_D	0.555	1.00
67_A	70_F	0.548	1.00
29_E	32_D	0.547	1.00
25_T	31_E	0.546	1.00
22_V	70_F	0.537	1.00
8_F	63_L	0.531	1.00
23_A	67_A	0.531	1.00
6_V	67_A	0.515	1.00
12_D	23_A	0.513	1.00
45_E	50_G	0.509	1.00
20_E	23_A	0.508	1.00
4_N	7_E	0.505	1.00
38_V	63_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jalA	1	0.4667	3.6	0.853	Contact Map
2dbyA	1	0.44	2.8	0.861	Contact Map
1ni3A	1	0.4267	2.7	0.862	Contact Map
3zbeA	1	0.4533	1.9	0.872	Contact Map
2q83A	1	0.24	1.9	0.872	Contact Map
4q5yA	2	0.52	1.7	0.875	Contact Map
3blzA	4	0.3067	1.6	0.876	Contact Map
3dukA	4	0.3467	1.4	0.881	Contact Map
2x5yA	1	0.3467	1.4	0.883	Contact Map
3cnxA	2	0.28	1.4	0.883	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.