DUF1290 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1290 - Protein of unknown function (DUF1290)

PFAM:	PF06947	Sequences: IPAEYAPYLAVAILAALDSVFGGIRAGLEGKFDDKVFVSGFFSNALLAALLAYLGDRLGVDLYLAAVVVFGVRIFQNLAIIRRHLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	86 (86)
Sequences:	1876 (810)
Seq/√Len:	87.4
META:	0.852

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_R	29_E	4.084	1.00
65_A	71_G	3.282	1.00
69_V	72_V	3.230	1.00
68_V	72_V	3.146	1.00
39_S	43_S	2.659	1.00
64_L	68_V	2.391	1.00
65_A	68_V	2.363	1.00
7_P	61_D	2.363	1.00
43_S	78_L	2.339	1.00
47_L	78_L	2.308	1.00
7_P	10_A	2.029	1.00
29_E	84_H	1.889	1.00
72_V	76_Q	1.844	1.00
64_L	67_V	1.650	1.00
52_A	64_L	1.598	1.00
24_I	50_L	1.510	1.00
12_A	15_A	1.509	1.00
14_L	74_I	1.488	1.00
18_D	73_R	1.456	0.99
19_S	45_A	1.386	0.99
62_L	71_G	1.381	0.99
66_A	70_F	1.315	0.99
79_A	83_R	1.314	0.99
23_G	32_F	1.289	0.99
61_D	64_L	1.286	0.99
28_L	81_I	1.273	0.98
49_A	56_D	1.258	0.98
51_L	71_G	1.195	0.98
19_S	23_G	1.185	0.97
23_G	27_G	1.137	0.97
22_G	40_G	1.113	0.96
5_Y	14_L	1.113	0.96
14_L	71_G	1.061	0.95
50_L	54_L	1.028	0.94
22_G	26_A	0.977	0.93
13_I	16_A	0.971	0.92
59_G	66_A	0.956	0.92
19_S	78_L	0.951	0.92
52_A	86_L	0.951	0.92
80_I	84_H	0.951	0.92
61_D	72_V	0.948	0.91
1_I	9_L	0.948	0.91
49_A	79_A	0.945	0.91
22_G	82_R	0.943	0.91
41_F	45_A	0.940	0.91
10_A	61_D	0.930	0.91
76_Q	79_A	0.929	0.91
37_F	68_V	0.927	0.91
77_N	82_R	0.922	0.90
6_A	10_A	0.916	0.90
13_I	72_V	0.911	0.90
21_F	47_L	0.897	0.89
11_V	52_A	0.894	0.89
80_I	83_R	0.873	0.88
62_L	67_V	0.872	0.88
21_F	43_S	0.871	0.88
21_F	24_I	0.863	0.87
23_G	76_Q	0.857	0.87
38_V	84_H	0.857	0.87
8_Y	65_A	0.849	0.86
2_P	48_A	0.822	0.84
47_L	58_L	0.820	0.84
20_V	41_F	0.818	0.84
46_L	85_L	0.817	0.84
7_P	52_A	0.804	0.83
71_G	75_F	0.794	0.82
18_D	82_R	0.790	0.82
66_A	86_L	0.760	0.79
25_R	80_I	0.759	0.79
10_A	14_L	0.749	0.78
28_L	84_H	0.740	0.78
66_A	69_V	0.738	0.77
12_A	49_A	0.710	0.75
45_A	66_A	0.708	0.74
31_K	35_K	0.700	0.74
36_V	83_R	0.698	0.73
4_E	24_I	0.698	0.73
21_F	34_D	0.693	0.73
22_G	39_S	0.690	0.73
41_F	44_N	0.689	0.72
45_A	50_L	0.685	0.72
20_V	52_A	0.683	0.72
52_A	75_F	0.681	0.72
34_D	37_F	0.679	0.71
53_Y	57_R	0.675	0.71
60_V	67_V	0.669	0.70
29_E	74_I	0.661	0.69
1_I	4_E	0.660	0.69
4_E	7_P	0.655	0.69
14_L	28_L	0.637	0.66
9_L	23_G	0.636	0.66
53_Y	63_Y	0.634	0.66
12_A	19_S	0.633	0.66
37_F	44_N	0.633	0.66
30_G	49_A	0.633	0.66
19_S	31_K	0.630	0.66
12_A	48_A	0.623	0.65
71_G	79_A	0.607	0.63
27_G	34_D	0.605	0.63
34_D	38_V	0.602	0.62
51_L	66_A	0.594	0.61
56_D	61_D	0.586	0.60
24_I	74_I	0.586	0.60
49_A	60_V	0.583	0.60
47_L	75_F	0.573	0.58
56_D	63_Y	0.570	0.58
73_R	77_N	0.566	0.57
7_P	11_V	0.565	0.57
81_I	86_L	0.562	0.57
67_V	71_G	0.559	0.57
45_A	76_Q	0.557	0.56
10_A	13_I	0.555	0.56
40_G	66_A	0.554	0.56
15_A	49_A	0.552	0.56
54_L	58_L	0.544	0.54
13_I	70_F	0.535	0.53
12_A	29_E	0.533	0.53
20_V	27_G	0.532	0.53
44_N	48_A	0.525	0.52
20_V	84_H	0.525	0.52
29_E	75_F	0.522	0.52
60_V	81_I	0.519	0.51
38_V	60_V	0.519	0.51
31_K	51_L	0.517	0.51
7_P	30_G	0.510	0.50
40_G	82_R	0.510	0.50
18_D	22_G	0.509	0.50
10_A	69_V	0.500	0.49
61_D	78_L	0.500	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lssA	2	0.2209	2.6	0.934	Contact Map
2w2dB	1	0.2791	2.1	0.938	Contact Map
4xp4A	1	1	1.9	0.939	Contact Map
1ihsI	1	0.0698	1.8	0.939	Contact Map
3o10A	2	0.3488	1.6	0.942	Contact Map
2nwlA	3	0.5116	1.5	0.942	Contact Map
2yvaA	4	0.3605	1.4	0.943	Contact Map
3swhA	1	0.6744	1.2	0.946	Contact Map
2fozA	1	0.3372	1	0.948	Contact Map
1vkyA	2	0.5	1	0.948	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.