GutM - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GutM - Glucitol operon activator protein (GutM)

PFAM:	PF06923	Sequences: WLILLLAVAWLLQLLLGYLQIKHFNKAFRELRRKGRVGIGRSKGRFRAGAIVLLAVDEDGRIVDAEKMQGVTVFARFKPLPELEGLSLDELREEDLFKEDKLLQKAL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	107 (100)
Sequences:	1079 (828)
Seq/√Len:	82.8
META:	0.635

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_K	64_D	4.634	1.00
27_A	66_E	4.136	1.00
54_L	83_L	2.616	1.00
64_D	79_P	2.552	1.00
23_H	76_R	2.496	1.00
24_F	39_I	2.356	1.00
15_L	19_L	2.325	1.00
7_A	11_L	2.219	1.00
61_R	87_S	2.197	1.00
3_I	7_A	2.169	1.00
66_E	79_P	2.044	1.00
22_K	26_K	2.039	1.00
27_A	30_E	1.967	1.00
54_L	65_A	1.907	1.00
81_P	84_E	1.846	1.00
64_D	84_E	1.688	1.00
36_R	56_V	1.677	1.00
30_E	66_E	1.646	1.00
37_V	55_A	1.517	0.99
11_L	15_L	1.486	0.99
7_A	10_W	1.436	0.99
86_L	90_E	1.415	0.99
3_I	10_W	1.337	0.99
75_A	78_K	1.324	0.99
16_L	20_Q	1.311	0.98
17_G	41_R	1.291	0.98
27_A	77_F	1.277	0.98
28_F	39_I	1.275	0.98
13_Q	20_Q	1.272	0.98
49_G	77_F	1.222	0.98
10_W	73_V	1.211	0.97
32_R	36_R	1.207	0.97
65_A	83_L	1.144	0.96
6_L	16_L	1.141	0.96
34_K	55_A	1.119	0.96
38_G	56_V	1.102	0.95
53_L	77_F	1.102	0.95
44_G	47_R	1.092	0.95
24_F	77_F	1.080	0.95
78_K	90_E	1.056	0.94
14_L	31_L	1.036	0.94
14_L	18_Y	1.032	0.94
65_A	84_E	1.028	0.93
21_I	68_M	1.025	0.93
8_V	59_D	1.017	0.93
35_G	40_G	1.004	0.93
17_G	21_I	0.994	0.92
19_L	26_K	0.986	0.92
43_K	51_I	0.985	0.92
49_G	68_M	0.969	0.91
4_L	8_V	0.968	0.91
24_F	28_F	0.962	0.91
32_R	38_G	0.960	0.91
96_L	99_E	0.935	0.90
17_G	51_I	0.919	0.89
37_V	41_R	0.917	0.89
31_L	66_E	0.916	0.89
49_G	71_V	0.914	0.89
79_P	84_E	0.911	0.88
32_R	91_L	0.908	0.88
72_T	75_A	0.907	0.88
43_K	46_F	0.901	0.88
14_L	17_G	0.897	0.88
67_K	82_E	0.890	0.87
65_A	80_L	0.881	0.87
8_V	82_E	0.859	0.85
33_R	79_P	0.852	0.85
57_D	61_R	0.837	0.84
90_E	94_E	0.829	0.83
25_N	37_V	0.825	0.83
51_I	68_M	0.814	0.82
83_L	99_E	0.811	0.82
27_A	68_M	0.811	0.82
75_A	79_P	0.807	0.82
4_L	81_P	0.802	0.81
37_V	53_L	0.801	0.81
67_K	80_L	0.797	0.81
39_I	48_A	0.792	0.80
38_G	72_T	0.784	0.80
21_I	62_I	0.775	0.79
18_Y	47_R	0.774	0.79
9_A	45_R	0.761	0.78
42_S	50_A	0.758	0.77
28_F	69_Q	0.746	0.76
10_W	25_N	0.739	0.76
75_A	83_L	0.738	0.75
41_R	50_A	0.730	0.75
38_G	46_F	0.729	0.75
30_E	72_T	0.726	0.74
40_G	68_M	0.712	0.73
87_S	90_E	0.711	0.73
49_G	53_L	0.708	0.72
75_A	87_S	0.701	0.72
69_Q	100_D	0.697	0.71
50_A	69_Q	0.693	0.71
10_W	18_Y	0.690	0.70
38_G	48_A	0.688	0.70
53_L	66_E	0.686	0.70
8_V	15_L	0.682	0.70
79_P	82_E	0.680	0.69
3_I	17_G	0.680	0.69
38_G	88_L	0.679	0.69
56_V	65_A	0.678	0.69
44_G	51_I	0.666	0.68
21_I	69_Q	0.664	0.67
2_L	100_D	0.659	0.67
24_F	32_R	0.658	0.67
55_A	63_V	0.655	0.66
9_A	65_A	0.648	0.66
7_A	14_L	0.645	0.65
51_I	92_R	0.644	0.65
82_E	91_L	0.643	0.65
14_L	88_L	0.642	0.65
33_R	36_R	0.636	0.64
54_L	80_L	0.632	0.64
56_V	60_G	0.626	0.63
41_R	69_Q	0.624	0.63
70_G	74_F	0.622	0.62
8_V	94_E	0.616	0.62
3_I	14_L	0.611	0.61
17_G	69_Q	0.606	0.60
31_L	55_A	0.603	0.60
86_L	89_D	0.603	0.60
44_G	50_A	0.602	0.60
58_E	81_P	0.598	0.59
29_R	33_R	0.592	0.59
23_H	27_A	0.592	0.59
46_F	77_F	0.590	0.58
19_L	51_I	0.584	0.58
25_N	28_F	0.583	0.58
16_L	66_E	0.576	0.57
9_A	93_E	0.566	0.55
31_L	42_S	0.562	0.55
36_R	58_E	0.561	0.55
52_V	84_E	0.558	0.54
97_F	101_K	0.558	0.54
17_G	37_V	0.554	0.54
10_W	74_F	0.552	0.53
45_R	50_A	0.547	0.53
38_G	68_M	0.540	0.52
10_W	47_R	0.540	0.52
81_P	93_E	0.538	0.52
51_I	77_F	0.533	0.51
75_A	90_E	0.531	0.51
82_E	86_L	0.528	0.50
13_Q	72_T	0.525	0.50
42_S	77_F	0.515	0.49
13_Q	70_G	0.501	0.47
66_E	77_F	0.500	0.47
22_K	74_F	0.500	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3b33A	2	0.5701	33.8	0.891	Contact Map
2qkpA	2	0.7664	24.9	0.898	Contact Map
4hh2A	4	0.5234	22.3	0.9	Contact Map
1ll8A	1	0.5421	22	0.901	Contact Map
3ewkA	1	0.4579	21.6	0.901	Contact Map
4i5sA	2	0.8037	18.6	0.904	Contact Map
3a0sA	1	0.4673	17.1	0.906	Contact Map
1nwzA	1	0.7196	15.2	0.908	Contact Map
2gj3A	7	0.6075	15	0.908	Contact Map
3nhqA	2	0.5888	13.4	0.91	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.