DUF1272 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1272 - Protein of unknown function (DUF1272)

PFAM:	PF06906	Sequences: MLELRPNCECCDKDLPPDSTEARICSFECTFCADCAETVLGGVCPNCGGELVPRPIR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	57 (57)
Sequences:	9969 (2937)
Seq/√Len:	389.0
META:	0.952

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
23_R	36_A	2.925	1.00
7_N	12_D	2.864	1.00
50_E	56_I	2.574	1.00
23_R	33_A	2.320	1.00
10_C	39_V	2.237	1.00
33_A	37_E	2.023	1.00
34_D	38_T	1.885	1.00
26_S	57_R	1.783	1.00
21_E	33_A	1.738	1.00
7_N	14_D	1.722	1.00
23_R	42_G	1.674	1.00
50_E	53_P	1.559	1.00
16_P	19_S	1.546	1.00
31_F	46_N	1.402	1.00
29_C	46_N	1.378	1.00
36_A	51_L	1.348	1.00
13_K	21_E	1.336	1.00
2_L	24_I	1.288	1.00
10_C	40_L	1.254	1.00
7_N	10_C	1.230	1.00
31_F	45_P	1.224	1.00
13_K	34_D	1.218	1.00
32_C	35_C	1.187	1.00
24_I	28_E	1.181	1.00
53_P	56_I	1.156	1.00
5_R	9_E	1.081	1.00
23_R	53_P	1.074	1.00
4_L	56_I	1.025	1.00
17_P	56_I	1.018	1.00
10_C	38_T	0.995	1.00
1_M	10_C	0.995	1.00
31_F	39_V	0.965	1.00
37_E	42_G	0.956	1.00
31_F	51_L	0.939	1.00
20_T	56_I	0.936	1.00
23_R	37_E	0.921	1.00
2_L	28_E	0.921	1.00
6_P	14_D	0.904	1.00
6_P	17_P	0.859	1.00
36_A	39_V	0.851	1.00
34_D	37_E	0.845	1.00
4_L	17_P	0.845	1.00
44_C	47_C	0.814	1.00
43_V	48_G	0.804	1.00
10_C	14_D	0.797	1.00
21_E	53_P	0.779	1.00
38_T	41_G	0.776	1.00
6_P	12_D	0.775	1.00
36_A	42_G	0.772	1.00
52_V	56_I	0.767	1.00
15_L	22_A	0.758	1.00
6_P	16_P	0.721	1.00
36_A	40_L	0.711	1.00
10_C	27_F	0.706	1.00
4_L	28_E	0.699	1.00
18_D	56_I	0.690	0.99
20_T	33_A	0.685	0.99
26_S	50_E	0.670	0.99
37_E	41_G	0.661	0.99
30_T	35_C	0.652	0.99
25_C	32_C	0.649	0.99
54_R	57_R	0.640	0.99
22_A	31_F	0.636	0.99
25_C	28_E	0.632	0.99
2_L	26_S	0.612	0.99
20_T	53_P	0.604	0.99
47_C	54_R	0.591	0.98
37_E	40_L	0.584	0.98
39_V	43_V	0.578	0.98
20_T	50_E	0.567	0.98
43_V	50_E	0.562	0.98
33_A	53_P	0.558	0.98
21_E	56_I	0.553	0.98
28_E	35_C	0.546	0.97
16_P	22_A	0.538	0.97
25_C	29_C	0.536	0.97
25_C	35_C	0.536	0.97
9_E	45_P	0.535	0.97
14_D	48_G	0.525	0.97
26_S	30_T	0.524	0.97
12_D	16_P	0.521	0.96
31_F	36_A	0.518	0.96
2_L	48_G	0.514	0.96
34_D	41_G	0.512	0.96
36_A	41_G	0.511	0.96
13_K	19_S	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4txaA	1	1	81.8	0.802	Contact Map
1jm7B	1	0.9474	74.9	0.815	Contact Map
1e4uA	1	1	74.8	0.815	Contact Map
2ct2A	1	1	73	0.818	Contact Map
2jrpA	1	0.8947	72.2	0.819	Contact Map
1iymA	1	0.9123	72	0.819	Contact Map
2ectA	1	0.9825	68.6	0.823	Contact Map
2y1nA	1	0.9298	66.8	0.825	Contact Map
4ladB	1	0.7018	66.3	0.826	Contact Map
2eclA	1	1	65.2	0.827	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.