P2_Phage_GpR - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

P2_Phage_GpR - P2 phage tail completion protein R (GpR)

PFAM:	PF06891	Sequences: MKKPQSLRAALTAAVPELARNPDRLLVFIDNGRIVATGAGSLSFEYRYTLNLIITDFAGDPDLLMVPLLAWLRENQPDLLANPDKRLDGITFEADILDNDTADLSITLPLTERVIVKEDPDGGITVTHKPE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	131 (130)
Sequences:	1170 (881)
Seq/√Len:	77.2
META:	0.468

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
64_L	104_L	4.535	1.00
98_D	101_T	3.957	1.00
4_P	50_L	3.891	1.00
9_A	13_A	3.143	1.00
30_D	51_N	2.956	1.00
51_N	105_S	2.942	1.00
35_V	47_R	2.865	1.00
65_M	106_I	2.614	1.00
49_T	107_T	2.591	1.00
62_D	128_H	2.543	1.00
53_I	105_S	2.411	1.00
54_I	64_L	2.383	1.00
68_L	106_I	2.286	1.00
34_I	65_M	2.279	1.00
10_A	14_A	1.992	1.00
26_L	55_T	1.906	1.00
24_R	56_D	1.888	1.00
115_I	129_K	1.821	1.00
118_E	129_K	1.764	1.00
31_N	49_T	1.737	1.00
44_F	66_V	1.712	1.00
58_A	101_T	1.711	1.00
45_E	113_R	1.657	1.00
4_P	29_I	1.655	1.00
119_D	125_T	1.647	1.00
46_Y	92_F	1.613	1.00
59_G	63_L	1.593	1.00
46_Y	65_M	1.466	0.99
72_L	79_L	1.457	0.99
2_K	60_D	1.433	0.99
119_D	124_I	1.433	0.99
44_F	114_V	1.429	0.99
96_I	102_A	1.403	0.99
72_L	90_I	1.394	0.99
61_P	65_M	1.391	0.99
97_L	101_T	1.379	0.99
76_Q	79_L	1.368	0.99
83_P	86_R	1.366	0.98
49_T	109_P	1.358	0.98
119_D	123_G	1.357	0.98
33_R	109_P	1.307	0.98
76_Q	110_L	1.266	0.98
3_K	112_E	1.262	0.97
26_L	53_I	1.222	0.97
36_A	80_L	1.218	0.97
97_L	103_D	1.217	0.97
2_K	128_H	1.209	0.97
6_S	75_N	1.197	0.97
79_L	109_P	1.185	0.96
28_F	53_I	1.181	0.96
79_L	89_G	1.159	0.96
14_A	67_P	1.103	0.94
48_Y	112_E	1.094	0.94
46_Y	62_D	1.091	0.94
46_Y	67_P	1.085	0.94
93_E	105_S	1.084	0.94
33_R	47_R	1.063	0.93
68_L	90_I	1.053	0.93
47_R	111_T	1.040	0.93
75_N	110_L	1.024	0.92
94_A	104_L	1.016	0.92
8_R	25_L	1.001	0.91
47_R	109_P	0.998	0.91
10_A	15_V	0.993	0.91
63_L	123_G	0.970	0.90
5_Q	9_A	0.969	0.90
32_G	46_Y	0.915	0.87
117_K	127_T	0.908	0.86
82_N	85_K	0.906	0.86
58_A	102_A	0.906	0.86
35_V	86_R	0.901	0.86
91_T	109_P	0.896	0.86
91_T	107_T	0.881	0.85
54_I	104_L	0.872	0.84
56_D	101_T	0.857	0.83
30_D	105_S	0.853	0.83
15_V	67_P	0.845	0.82
84_D	87_L	0.832	0.81
27_V	50_L	0.825	0.81
85_K	88_D	0.823	0.80
10_A	13_A	0.822	0.80
63_L	67_P	0.820	0.80
41_S	116_V	0.815	0.80
18_L	71_W	0.806	0.79
33_R	52_L	0.805	0.79
61_P	102_A	0.804	0.79
6_S	10_A	0.798	0.78
7_L	10_A	0.791	0.78
38_G	81_A	0.789	0.78
72_L	80_L	0.787	0.77
54_I	60_D	0.782	0.77
32_G	92_F	0.778	0.77
58_A	70_A	0.777	0.77
70_A	124_I	0.774	0.76
10_A	67_P	0.771	0.76
118_E	122_G	0.766	0.75
6_S	71_W	0.765	0.75
57_F	94_A	0.737	0.73
7_L	71_W	0.733	0.72
44_F	69_L	0.718	0.71
127_T	130_P	0.712	0.70
33_R	91_T	0.711	0.70
34_I	120_P	0.711	0.70
70_A	74_E	0.711	0.70
28_F	55_T	0.708	0.70
118_E	124_I	0.703	0.69
66_V	126_V	0.702	0.69
48_Y	104_L	0.700	0.69
83_P	87_L	0.699	0.69
65_M	92_F	0.691	0.68
78_D	108_L	0.689	0.68
46_Y	114_V	0.685	0.67
3_K	111_T	0.679	0.66
68_L	107_T	0.677	0.66
18_L	54_I	0.671	0.65
87_L	90_I	0.669	0.65
8_R	18_L	0.669	0.65
21_N	24_R	0.668	0.65
9_A	12_T	0.667	0.65
87_L	100_D	0.666	0.65
21_N	27_V	0.662	0.64
38_G	73_R	0.657	0.64
4_P	27_V	0.648	0.63
3_K	76_Q	0.641	0.62
32_G	43_S	0.641	0.62
28_F	103_D	0.638	0.62
2_K	75_N	0.637	0.61
73_R	81_A	0.627	0.60
117_K	129_K	0.625	0.60
25_L	111_T	0.620	0.59
21_N	29_I	0.613	0.59
39_A	73_R	0.613	0.59
118_E	121_D	0.612	0.58
22_P	67_P	0.609	0.58
11_L	72_L	0.608	0.58
30_D	92_F	0.602	0.57
31_N	91_T	0.601	0.57
15_V	97_L	0.600	0.57
50_L	110_L	0.600	0.57
36_A	86_R	0.599	0.57
94_A	119_D	0.599	0.57
51_N	107_T	0.586	0.55
66_V	86_R	0.586	0.55
52_L	81_A	0.584	0.55
72_L	89_G	0.582	0.55
56_D	103_D	0.581	0.55
43_S	115_I	0.576	0.54
116_V	126_V	0.572	0.53
17_E	20_R	0.569	0.53
82_N	86_R	0.568	0.53
43_S	124_I	0.567	0.53
53_I	103_D	0.565	0.53
118_E	123_G	0.560	0.52
28_F	52_L	0.559	0.52
37_T	45_E	0.556	0.51
61_P	124_I	0.556	0.51
50_L	77_P	0.555	0.51
48_Y	64_L	0.552	0.51
53_I	93_E	0.550	0.51
16_P	20_R	0.549	0.50
81_A	85_K	0.548	0.50
68_L	92_F	0.544	0.50
33_R	87_L	0.543	0.50
63_L	74_E	0.540	0.49
45_E	111_T	0.538	0.49
119_D	127_T	0.537	0.49
95_D	126_V	0.537	0.49
43_S	66_V	0.532	0.48
121_D	127_T	0.530	0.48
24_R	69_L	0.529	0.48
45_E	76_Q	0.528	0.48
50_L	80_L	0.526	0.48
72_L	88_D	0.525	0.47
11_L	108_L	0.523	0.47
64_L	69_L	0.522	0.47
57_F	65_M	0.521	0.47
47_R	126_V	0.519	0.47
50_L	76_Q	0.518	0.47
117_K	124_I	0.516	0.46
45_E	78_D	0.514	0.46
68_L	72_L	0.514	0.46
83_P	109_P	0.513	0.46
31_N	52_L	0.513	0.46
55_T	97_L	0.511	0.46
30_D	95_D	0.511	0.46
17_E	59_G	0.510	0.46
63_L	66_V	0.509	0.45
41_S	115_I	0.508	0.45
47_R	51_N	0.508	0.45
50_L	108_L	0.506	0.45
36_A	69_L	0.505	0.45
32_G	77_P	0.503	0.45
67_P	113_R	0.502	0.45
34_I	99_N	0.500	0.44
42_L	70_A	0.500	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1yfnA	2	0.7023	31.6	0.908	Contact Map
1ou8A	2	0.6794	12.9	0.923	Contact Map
4miwA	1	0.3893	6.8	0.933	Contact Map
3l6iA	2	0.2901	6.7	0.933	Contact Map
2y9yB	1	0.3511	5.7	0.935	Contact Map
3nr7A	2	0.2137	5.3	0.936	Contact Map
4oh8B	1	0.1298	3.9	0.94	Contact Map
2xvlA	1	0.7557	3.8	0.94	Contact Map
3fm3A	1	0.5038	3.6	0.941	Contact Map
4ydzA	4	0.458	3.6	0.941	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.