DUF1266 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1266 - Protein of unknown function (DUF1266)

PFAM:	PF06889	Sequences: MLEEWWGITDRESLLETLEWLLEGGHRAEFDELAEALRALSAAELDEELAELEEDEEDLARAEEALRYARVRRYYERLGADGILAWDLGRAVNLARWGYAAGYLTEEEAWDLILRAARLAQETYSSWEEFAASYLLGRAFWSGEDEEDEASWYEERLEIYRELLTDPDSPWRTLPW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	176 (171)
Sequences:	1885 (1567)
Seq/√Len:	119.8
META:	0.655

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
14_L	98_G	6.022	1.00
10_D	13_S	5.926	1.00
124_Y	133_S	5.810	1.00
11_R	15_L	4.108	1.00
11_R	108_E	3.930	1.00
92_V	113_I	3.597	1.00
120_A	130_F	3.397	1.00
89_G	130_F	3.227	1.00
125_S	129_E	3.060	1.00
93_N	97_W	2.797	1.00
106_E	110_W	2.732	1.00
9_T	13_S	2.693	1.00
105_T	108_E	2.672	1.00
85_A	124_Y	2.639	1.00
20_W	25_G	2.375	1.00
131_A	171_W	2.278	1.00
86_W	141_W	2.220	1.00
91_A	116_A	2.179	1.00
26_H	141_W	2.120	1.00
20_W	24_G	2.069	1.00
10_D	103_Y	1.990	1.00
85_A	130_F	1.909	1.00
88_L	120_A	1.843	1.00
3_E	9_T	1.819	1.00
110_W	113_I	1.706	1.00
118_R	121_Q	1.697	1.00
25_G	87_D	1.682	1.00
131_A	160_Y	1.628	1.00
22_L	91_A	1.607	1.00
85_A	133_S	1.581	1.00
18_L	91_A	1.569	1.00
89_G	134_Y	1.534	1.00
90_R	141_W	1.512	1.00
90_R	138_R	1.478	1.00
86_W	90_R	1.474	1.00
87_D	90_R	1.464	1.00
95_A	116_A	1.439	1.00
14_L	95_A	1.418	1.00
3_E	7_G	1.413	1.00
138_R	156_R	1.371	1.00
169_S	172_R	1.325	1.00
6_W	21_L	1.319	1.00
33_L	140_F	1.307	1.00
17_T	20_W	1.292	1.00
128_E	164_L	1.215	0.99
99_Y	106_E	1.210	0.99
26_H	86_W	1.204	0.99
21_L	90_R	1.182	0.99
126_S	129_E	1.171	0.99
14_L	94_L	1.171	0.99
45_L	49_L	1.168	0.99
95_A	113_I	1.146	0.99
89_G	138_R	1.143	0.99
14_L	104_L	1.124	0.99
70_R	74_Y	1.115	0.99
117_A	121_Q	1.101	0.99
114_L	121_Q	1.093	0.99
18_L	112_L	1.089	0.98
163_L	169_S	1.083	0.98
15_L	104_L	1.072	0.98
92_V	120_A	1.070	0.98
65_A	69_A	1.039	0.98
2_L	101_A	1.018	0.98
79_G	83_I	1.017	0.98
27_R	31_D	0.993	0.97
74_Y	136_L	0.989	0.97
30_F	34_A	0.979	0.97
8_I	98_G	0.968	0.97
6_W	141_W	0.966	0.97
135_L	156_R	0.965	0.97
165_T	172_R	0.959	0.97
19_E	23_E	0.953	0.96
6_W	90_R	0.944	0.96
46_D	49_L	0.942	0.96
83_I	140_F	0.923	0.96
78_L	82_G	0.922	0.96
96_R	113_I	0.911	0.95
61_R	64_E	0.910	0.95
20_W	26_H	0.909	0.95
41_S	44_E	0.900	0.95
70_R	77_R	0.885	0.95
19_E	115_R	0.881	0.95
57_E	60_A	0.880	0.94
94_L	98_G	0.879	0.94
74_Y	78_L	0.874	0.94
62_A	66_L	0.873	0.94
90_R	134_Y	0.868	0.94
109_A	113_I	0.865	0.94
158_E	162_E	0.859	0.94
21_L	91_A	0.856	0.94
44_E	47_E	0.850	0.93
72_R	77_R	0.848	0.93
99_Y	109_A	0.847	0.93
74_Y	81_D	0.839	0.93
51_E	56_E	0.829	0.93
89_G	120_A	0.829	0.93
26_H	90_R	0.822	0.92
18_L	95_A	0.821	0.92
108_E	112_L	0.820	0.92
34_A	75_Y	0.819	0.92
75_Y	79_G	0.815	0.92
158_E	166_D	0.814	0.92
20_W	27_R	0.810	0.92
156_R	160_Y	0.804	0.91
22_L	116_A	0.803	0.91
123_T	130_F	0.799	0.91
153_Y	157_L	0.797	0.91
161_R	165_T	0.795	0.91
120_A	133_S	0.793	0.91
40_L	44_E	0.792	0.91
5_W	90_R	0.792	0.91
96_R	110_W	0.791	0.91
95_A	112_L	0.791	0.91
154_E	158_E	0.788	0.91
17_T	26_H	0.785	0.90
57_E	61_R	0.784	0.90
66_L	69_A	0.782	0.90
74_Y	82_G	0.779	0.90
84_L	123_T	0.774	0.90
64_E	67_R	0.770	0.90
138_R	141_W	0.761	0.89
56_E	62_A	0.753	0.88
30_F	176_W	0.753	0.88
75_Y	82_G	0.752	0.88
48_E	52_L	0.752	0.88
83_I	133_S	0.733	0.87
19_E	112_L	0.732	0.87
77_R	80_A	0.729	0.87
8_I	14_L	0.728	0.87
155_E	158_E	0.724	0.86
52_L	59_L	0.719	0.86
74_Y	83_I	0.719	0.86
15_L	108_E	0.716	0.86
56_E	60_A	0.712	0.86
71_V	75_Y	0.711	0.85
74_Y	77_R	0.710	0.85
78_L	83_I	0.709	0.85
159_I	163_L	0.709	0.85
34_A	37_L	0.702	0.85
53_E	56_E	0.700	0.85
126_S	176_W	0.696	0.84
7_G	17_T	0.689	0.84
22_L	133_S	0.686	0.83
24_G	28_A	0.684	0.83
54_E	57_E	0.684	0.83
41_S	45_L	0.681	0.83
89_G	92_V	0.681	0.83
113_I	116_A	0.680	0.83
56_E	59_L	0.678	0.83
112_L	115_R	0.676	0.82
58_D	61_R	0.672	0.82
15_L	112_L	0.671	0.82
104_L	107_E	0.670	0.82
50_A	53_E	0.669	0.82
63_E	66_L	0.669	0.82
96_R	138_R	0.665	0.81
14_L	18_L	0.663	0.81
119_L	122_E	0.663	0.81
15_L	91_A	0.663	0.81
139_A	153_Y	0.659	0.81
27_R	84_L	0.658	0.81
153_Y	156_R	0.645	0.79
27_R	30_F	0.643	0.79
33_L	36_A	0.642	0.79
59_L	62_A	0.639	0.79
110_W	131_A	0.637	0.79
27_R	88_L	0.637	0.79
161_R	164_L	0.635	0.78
93_N	96_R	0.632	0.78
12_E	16_E	0.624	0.77
61_R	65_A	0.620	0.77
51_E	55_D	0.620	0.77
29_E	33_L	0.618	0.76
109_A	114_L	0.614	0.76
156_R	161_R	0.613	0.76
46_D	50_A	0.613	0.76
78_L	136_L	0.609	0.75
63_E	67_R	0.606	0.75
2_L	6_W	0.605	0.75
6_W	138_R	0.604	0.75
81_D	84_L	0.598	0.74
79_G	82_G	0.596	0.74
97_W	171_W	0.593	0.74
52_L	56_E	0.593	0.74
27_R	87_D	0.592	0.73
53_E	58_D	0.589	0.73
18_L	104_L	0.589	0.73
95_A	136_L	0.589	0.73
96_R	136_L	0.589	0.73
162_E	166_D	0.588	0.73
62_A	65_A	0.587	0.73
83_I	137_G	0.587	0.73
55_D	59_L	0.586	0.73
75_Y	78_L	0.583	0.72
25_G	90_R	0.581	0.72
159_I	165_T	0.580	0.72
157_L	161_R	0.580	0.72
44_E	48_E	0.577	0.72
22_L	115_R	0.577	0.72
64_E	69_A	0.577	0.72
92_V	116_A	0.575	0.71
85_A	120_A	0.573	0.71
128_E	132_A	0.573	0.71
83_I	134_Y	0.573	0.71
168_D	173_T	0.573	0.71
134_Y	141_W	0.573	0.71
101_A	145_D	0.572	0.71
46_D	57_E	0.568	0.70
110_W	138_R	0.564	0.70
157_L	162_E	0.564	0.70
48_E	56_E	0.563	0.70
47_E	50_A	0.561	0.69
55_D	62_A	0.560	0.69
78_L	134_Y	0.555	0.69
9_T	12_E	0.555	0.69
56_E	64_E	0.553	0.68
162_E	165_T	0.553	0.68
55_D	58_D	0.552	0.68
128_E	131_A	0.551	0.68
90_R	94_L	0.551	0.68
17_T	24_G	0.550	0.68
170_P	174_L	0.547	0.67
52_L	55_D	0.547	0.67
71_V	76_E	0.546	0.67
114_L	117_A	0.546	0.67
86_W	138_R	0.543	0.67
166_D	169_S	0.542	0.67
79_G	84_L	0.540	0.66
156_R	159_I	0.535	0.66
26_H	87_D	0.533	0.65
108_E	121_Q	0.527	0.65
6_W	94_L	0.527	0.65
27_R	82_G	0.525	0.64
6_W	86_W	0.524	0.64
88_L	119_L	0.524	0.64
56_E	61_R	0.523	0.64
89_G	124_Y	0.522	0.64
13_S	17_T	0.522	0.64
134_Y	138_R	0.519	0.63
98_G	171_W	0.518	0.63
85_A	138_R	0.518	0.63
12_E	15_L	0.516	0.63
112_L	116_A	0.515	0.63
115_R	122_E	0.512	0.62
103_Y	133_S	0.510	0.62
152_W	160_Y	0.509	0.62
140_F	143_G	0.509	0.62
155_E	159_I	0.508	0.62
109_A	134_Y	0.508	0.62
54_E	58_D	0.506	0.62
4_E	122_E	0.505	0.61
111_D	114_L	0.504	0.61
27_R	113_I	0.502	0.61
28_A	31_D	0.501	0.61
3_E	13_S	0.501	0.61
32_E	35_E	0.500	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4gl3A	1	0.75	12.6	0.925	Contact Map
3q4oA	2	0.5966	10.6	0.928	Contact Map
1jg7A	1	0.3352	4.7	0.939	Contact Map
3tixB	1	0.3977	3.7	0.942	Contact Map
1wtyA	4	0.6591	3.6	0.942	Contact Map
4kbmB	1	0.5341	3.6	0.942	Contact Map
3kluA	1	0.2216	3.3	0.943	Contact Map
4jrbA	1	0.4432	2.8	0.945	Contact Map
1eswA	1	0.7898	2.8	0.945	Contact Map
3iukA	1	0.9489	2.7	0.946	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.