TPX2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TPX2 - Targeting protein for Xklp2 (TPX2)

PFAM:	PF06886	Sequences: LHTDERAEERKEFDKKLEEKEAAKEAEKEEREAERKEEEEEEIKQLRKSLVFKANPM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	57 (57)
Sequences:	825 (488)
Seq/√Len:	64.7
META:	0.274

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_Q	49_S	2.292	1.00
28_K	32_E	2.074	1.00
45_Q	48_K	1.935	1.00
40_E	44_K	1.891	1.00
5_E	9_E	1.883	1.00
14_D	17_L	1.871	1.00
34_E	38_E	1.860	1.00
32_E	36_K	1.802	1.00
36_K	40_E	1.773	1.00
12_E	15_K	1.751	1.00
46_L	50_L	1.695	0.99
15_K	19_E	1.611	0.99
8_E	11_K	1.593	0.99
52_F	55_N	1.538	0.99
43_I	50_L	1.490	0.98
19_E	22_A	1.473	0.98
2_H	5_E	1.391	0.98
29_E	32_E	1.355	0.97
13_F	17_L	1.342	0.97
30_E	34_E	1.331	0.97
18_E	21_E	1.262	0.96
35_R	38_E	1.234	0.95
25_E	29_E	1.204	0.94
42_E	45_Q	1.199	0.94
26_A	30_E	1.196	0.94
10_R	13_F	1.172	0.94
1_L	7_A	1.166	0.93
38_E	42_E	1.155	0.93
31_R	34_E	1.152	0.93
33_A	37_E	1.146	0.93
37_E	41_E	1.129	0.92
9_E	12_E	1.125	0.92
51_V	55_N	1.069	0.90
23_A	27_E	1.009	0.87
51_V	57_M	1.002	0.87
13_F	20_K	0.968	0.85
19_E	23_A	0.966	0.85
17_L	20_K	0.964	0.85
18_E	49_S	0.898	0.80
15_K	22_A	0.858	0.77
13_F	57_M	0.822	0.74
1_L	21_E	0.820	0.74
35_R	39_E	0.813	0.73
31_R	35_R	0.809	0.73
41_E	49_S	0.800	0.72
27_E	30_E	0.796	0.71
15_K	51_V	0.781	0.70
8_E	53_K	0.774	0.69
5_E	37_E	0.774	0.69
41_E	45_Q	0.737	0.66
14_D	56_P	0.733	0.65
9_E	46_L	0.719	0.64
1_L	32_E	0.709	0.63
30_E	33_A	0.707	0.62
7_A	54_A	0.693	0.61
18_E	22_A	0.688	0.60
20_K	23_A	0.688	0.60
16_K	20_K	0.678	0.59
23_A	26_A	0.669	0.58
29_E	57_M	0.661	0.57
52_F	56_P	0.660	0.57
29_E	39_E	0.647	0.56
20_K	38_E	0.643	0.55
13_F	43_I	0.641	0.55
29_E	33_A	0.639	0.55
43_I	57_M	0.637	0.54
48_K	54_A	0.630	0.54
24_K	55_N	0.625	0.53
9_E	41_E	0.624	0.53
24_K	28_K	0.622	0.53
29_E	37_E	0.618	0.52
16_K	27_E	0.602	0.50
17_L	21_E	0.602	0.50
3_T	51_V	0.593	0.49
14_D	57_M	0.593	0.49
47_R	56_P	0.590	0.49
26_A	44_K	0.569	0.46
14_D	51_V	0.561	0.46
24_K	42_E	0.556	0.45
11_K	18_E	0.548	0.44
5_E	17_L	0.533	0.42
11_K	15_K	0.527	0.42
30_E	38_E	0.523	0.41
38_E	41_E	0.514	0.40
52_F	57_M	0.509	0.40
42_E	55_N	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4a9aC	1	0.4737	2.1	0.863	Contact Map
3vp9A	3	0.9825	1.8	0.868	Contact Map
4bjtA	1	0.3333	1.6	0.871	Contact Map
4htmA	1	0.3509	1.3	0.88	Contact Map
4q2jA	3	0.3684	1.1	0.883	Contact Map
2dodA	1	0.5088	1.1	0.885	Contact Map
4uera	1	0	0.9	0.889	Contact Map
4trhA	2	1	0.9	0.89	Contact Map
4b2zA	1	1	0.9	0.891	Contact Map
4oojA	3	1	0.8	0.892	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.