DUF1230 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1230 - Protein of unknown function (DUF1230)

PFAM:	PF06799	Sequences: CPVPKEQQPLNEYIELKESWFFSWPTLSKKSYLKKLIWFWLLSFLLFGPIAAGSFPPKKSPLKFILLSAFGALLIPLLILLRLYLGWSYVRKRLLSETVEYEESGWYDGQVWEKPLEVLERDRLIASYEVKPILKRLKQTLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	142 (141)
Sequences:	723 (450)
Seq/√Len:	37.9
META:	0.712

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
12_E	15_E	4.494	1.00
32_Y	140_T	4.295	1.00
82_R	85_L	3.316	1.00
22_F	86_G	3.018	1.00
119_L	123_R	2.786	1.00
12_E	89_Y	2.581	1.00
60_S	63_K	2.448	1.00
30_K	34_K	2.409	1.00
14_I	17_K	2.248	0.99
91_R	126_A	2.201	0.99
61_P	65_I	2.169	0.99
133_I	137_L	2.093	0.99
5_K	8_Q	2.090	0.99
97_E	119_L	2.010	0.99
40_W	44_F	1.943	0.98
4_P	7_Q	1.876	0.98
92_K	121_R	1.847	0.98
10_L	125_I	1.816	0.97
82_R	86_G	1.815	0.97
44_F	72_A	1.756	0.97
24_W	84_Y	1.732	0.97
99_V	118_V	1.732	0.97
22_F	85_L	1.732	0.97
112_W	115_P	1.728	0.97
85_L	89_Y	1.716	0.96
44_F	48_G	1.621	0.95
82_R	89_Y	1.589	0.94
121_R	125_I	1.573	0.94
57_P	64_F	1.539	0.93
35_K	75_I	1.518	0.93
135_K	139_Q	1.513	0.93
96_S	99_V	1.504	0.93
27_L	50_I	1.469	0.92
2_P	112_W	1.469	0.92
12_E	17_K	1.461	0.91
126_A	130_V	1.460	0.91
44_F	68_S	1.387	0.89
9_P	12_E	1.384	0.89
46_L	131_K	1.338	0.87
56_P	81_L	1.318	0.87
103_E	110_Q	1.295	0.86
93_R	108_D	1.256	0.84
10_L	50_I	1.236	0.83
22_F	82_R	1.232	0.83
28_S	98_T	1.231	0.83
80_L	83_L	1.206	0.81
8_Q	121_R	1.189	0.80
4_P	9_P	1.174	0.79
32_Y	111_V	1.169	0.79
21_F	83_L	1.169	0.79
38_W	42_L	1.168	0.79
49_P	64_F	1.149	0.78
32_Y	99_V	1.148	0.78
3_V	94_L	1.140	0.77
40_W	76_P	1.113	0.76
30_K	36_L	1.112	0.76
40_W	72_A	1.096	0.74
25_P	121_R	1.076	0.73
52_A	55_F	1.070	0.73
27_L	35_K	1.046	0.71
51_A	68_S	1.040	0.71
14_I	121_R	1.036	0.70
75_I	120_E	1.034	0.70
98_T	113_E	1.027	0.70
89_Y	94_L	1.024	0.69
61_P	71_G	1.022	0.69
86_G	140_T	1.018	0.69
1_C	4_P	1.010	0.68
95_L	126_A	0.998	0.67
35_K	38_W	0.974	0.65
49_P	55_F	0.963	0.64
36_L	80_L	0.958	0.64
86_G	129_E	0.957	0.64
42_L	90_V	0.946	0.63
61_P	77_L	0.930	0.62
12_E	93_R	0.922	0.61
40_W	69_A	0.913	0.60
3_V	7_Q	0.912	0.60
8_Q	89_Y	0.910	0.60
94_L	109_G	0.905	0.60
36_L	75_I	0.900	0.59
33_L	60_S	0.896	0.59
105_G	128_Y	0.894	0.59
1_C	107_Y	0.886	0.58
48_G	64_F	0.885	0.58
13_Y	17_K	0.880	0.57
45_L	70_F	0.875	0.57
48_G	68_S	0.874	0.57
24_W	39_F	0.869	0.56
40_W	54_S	0.869	0.56
105_G	121_R	0.868	0.56
1_C	13_Y	0.860	0.56
2_P	13_Y	0.858	0.56
5_K	11_N	0.843	0.54
47_F	72_A	0.843	0.54
11_N	74_L	0.842	0.54
88_S	92_K	0.838	0.54
37_I	63_K	0.832	0.53
138_K	141_L	0.820	0.52
81_L	113_E	0.807	0.51
49_P	71_G	0.802	0.51
10_L	95_L	0.799	0.50
17_K	26_T	0.799	0.50
13_Y	112_W	0.797	0.50
80_L	141_L	0.793	0.50
110_Q	134_L	0.792	0.50
70_F	141_L	0.791	0.50
121_R	127_S	0.789	0.49
115_P	118_V	0.782	0.49
11_N	14_I	0.780	0.49
16_L	85_L	0.779	0.49
31_S	74_L	0.775	0.48
29_K	125_I	0.775	0.48
99_V	105_G	0.774	0.48
87_W	122_D	0.774	0.48
38_W	104_S	0.771	0.48
55_F	71_G	0.770	0.48
63_K	99_V	0.769	0.48
39_F	45_L	0.768	0.48
35_K	76_P	0.765	0.47
40_W	68_S	0.761	0.47
89_Y	99_V	0.758	0.47
36_L	76_P	0.754	0.46
120_E	129_E	0.744	0.45
19_S	22_F	0.742	0.45
48_G	76_P	0.724	0.44
34_K	41_L	0.723	0.44
42_L	135_K	0.720	0.43
8_Q	98_T	0.717	0.43
41_L	69_A	0.714	0.43
73_L	100_E	0.714	0.43
29_K	34_K	0.708	0.42
22_F	125_I	0.698	0.41
9_P	106_W	0.697	0.41
82_R	90_V	0.695	0.41
88_S	130_V	0.693	0.41
107_Y	110_Q	0.693	0.41
116_L	120_E	0.691	0.41
27_L	32_Y	0.688	0.41
2_P	19_S	0.687	0.40
5_K	72_A	0.686	0.40
8_Q	105_G	0.681	0.40
99_V	111_V	0.678	0.40
68_S	95_L	0.675	0.39
26_T	47_F	0.669	0.39
27_L	31_S	0.667	0.39
20_W	24_W	0.667	0.39
135_K	138_K	0.663	0.38
45_L	125_I	0.658	0.38
92_K	135_K	0.657	0.38
86_G	94_L	0.633	0.36
32_Y	124_L	0.632	0.36
75_I	96_S	0.632	0.36
116_L	119_L	0.631	0.36
80_L	125_I	0.630	0.36
54_S	133_I	0.627	0.35
17_K	89_Y	0.626	0.35
10_L	120_E	0.624	0.35
42_L	58_K	0.620	0.35
44_F	52_A	0.618	0.35
24_W	113_E	0.617	0.35
97_E	113_E	0.617	0.35
49_P	53_G	0.614	0.34
23_S	71_G	0.613	0.34
44_F	64_F	0.612	0.34
1_C	112_W	0.608	0.34
20_W	25_P	0.606	0.34
19_S	83_L	0.601	0.33
83_L	123_R	0.599	0.33
80_L	90_V	0.596	0.33
51_A	67_L	0.593	0.33
32_Y	136_R	0.591	0.33
70_F	135_K	0.589	0.32
3_V	9_P	0.588	0.32
18_E	139_Q	0.588	0.32
2_P	10_L	0.587	0.32
98_T	120_E	0.585	0.32
15_E	89_Y	0.585	0.32
8_Q	100_E	0.584	0.32
28_S	97_E	0.581	0.32
45_L	137_L	0.580	0.32
9_P	13_Y	0.576	0.31
22_F	27_L	0.568	0.31
59_K	141_L	0.564	0.30
76_P	120_E	0.560	0.30
15_E	137_L	0.559	0.30
41_L	59_K	0.557	0.30
93_R	109_G	0.555	0.30
59_K	64_F	0.547	0.29
82_R	94_L	0.547	0.29
47_F	77_L	0.547	0.29
56_P	59_K	0.544	0.29
52_A	78_L	0.535	0.28
6_E	27_L	0.535	0.28
2_P	7_Q	0.533	0.28
89_Y	105_G	0.531	0.28
11_N	41_L	0.531	0.28
18_E	31_S	0.530	0.28
11_N	120_E	0.529	0.28
85_L	135_K	0.529	0.28
86_G	89_Y	0.526	0.28
98_T	111_V	0.523	0.27
91_R	130_V	0.521	0.27
26_T	37_I	0.520	0.27
50_I	94_L	0.516	0.27
96_S	100_E	0.508	0.26
57_P	71_G	0.508	0.26
45_L	65_I	0.506	0.26
60_S	126_A	0.506	0.26
39_F	79_I	0.504	0.26
58_K	61_P	0.503	0.26
47_F	58_K	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4d2gD	1	0.1127	11.3	0.949	Contact Map
1acfA	1	0.331	3.1	0.961	Contact Map
3ov1A	2	0.2958	3	0.961	Contact Map
1h9oA	1	0.338	2.8	0.962	Contact Map
1r1pA	4	0.331	2.7	0.962	Contact Map
2c9wA	1	0.3662	2.6	0.962	Contact Map
2eyzA	1	0.3451	2.4	0.963	Contact Map
2mdlA	1	0.1268	2.4	0.963	Contact Map
1i3zA	1	0.2887	2.2	0.964	Contact Map
1nrvA	1	0.3028	2	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.