Seipin - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Seipin - Putative adipose-regulatory protein (Seipin)

PFAM:	PF06775	Sequences: ILLLWLSVFLYGLFYYLYIPPVSLERPLHFQYGLCSFPYATVSLTSNGRLGPVLPPGQPYDVSLELELPESPYNRDLGNFMVRLELLSADGKVLASSRRPAMLRYRSPLVRLLRTLLFSPPLLLGLSEPETQTLTVPLFENYEEDRGSPNTTSARVELSSRELQIYSASLRIEARLPGLRYLMYNWPITSFVVGSSLF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	198 (192)
Sequences:	585 (458)
Seq/√Len:	33.1
META:	0.154

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
104_R	132_Q	4.387	1.00
11_Y	15_Y	4.385	1.00
154_A	170_L	4.368	1.00
107_S	130_E	4.301	1.00
191_F	195_S	3.092	1.00
14_F	18_Y	2.861	1.00
85_E	96_S	2.552	1.00
15_Y	20_P	2.536	1.00
70_E	132_Q	2.524	1.00
69_P	74_N	2.499	1.00
15_Y	19_I	2.427	0.99
11_Y	183_M	2.303	0.99
69_P	166_Y	2.282	0.99
28_L	40_A	2.276	0.99
78_G	107_S	2.206	0.99
186_W	189_T	2.101	0.98
83_R	98_R	1.928	0.97
14_F	58_Q	1.864	0.97
125_G	132_Q	1.860	0.97
15_Y	18_Y	1.840	0.96
11_Y	20_P	1.823	0.96
81_M	178_G	1.807	0.96
13_L	17_L	1.803	0.96
71_S	164_Q	1.774	0.96
10_L	14_F	1.730	0.95
158_L	165_I	1.691	0.94
65_E	171_R	1.678	0.94
7_S	13_L	1.646	0.93
103_L	158_L	1.637	0.93
25_E	138_L	1.610	0.93
62_V	76_D	1.605	0.92
64_L	138_L	1.565	0.91
11_Y	19_I	1.565	0.91
190_S	194_G	1.463	0.88
64_L	154_A	1.434	0.87
9_F	16_Y	1.416	0.87
177_P	180_R	1.394	0.86
8_V	134_L	1.389	0.86
60_Y	178_G	1.387	0.86
84_L	154_A	1.384	0.85
176_L	185_N	1.381	0.85
29_H	100_P	1.373	0.85
41_T	153_S	1.368	0.85
178_G	181_Y	1.367	0.85
70_E	104_R	1.345	0.84
95_A	139_F	1.337	0.83
71_S	130_E	1.334	0.83
71_S	166_Y	1.331	0.83
62_V	71_S	1.310	0.82
38_P	78_G	1.309	0.82
15_Y	183_M	1.308	0.82
166_Y	174_A	1.298	0.81
189_T	193_V	1.297	0.81
71_S	74_N	1.290	0.81
92_K	117_L	1.290	0.81
62_V	86_L	1.287	0.81
111_R	132_Q	1.262	0.80
44_L	47_N	1.260	0.79
159_S	184_Y	1.252	0.79
187_P	190_S	1.248	0.79
147_G	156_V	1.240	0.78
65_E	133_T	1.232	0.78
81_M	100_P	1.222	0.77
57_G	138_L	1.217	0.77
4_L	165_I	1.214	0.77
80_F	101_A	1.201	0.76
30_F	158_L	1.190	0.75
79_N	102_M	1.181	0.75
3_L	32_Y	1.173	0.74
10_L	13_L	1.168	0.74
57_G	68_L	1.156	0.73
14_F	179_L	1.153	0.73
32_Y	192_V	1.151	0.73
123_L	130_E	1.151	0.73
65_E	135_T	1.121	0.71
65_E	169_S	1.098	0.69
174_A	184_Y	1.090	0.69
68_L	154_A	1.077	0.68
122_L	132_Q	1.075	0.68
9_F	19_I	1.072	0.67
31_Q	100_P	1.070	0.67
14_F	17_L	1.062	0.67
107_S	115_T	1.054	0.66
123_L	186_W	1.052	0.66
27_P	99_R	1.049	0.66
69_P	78_G	1.049	0.66
22_V	176_L	1.046	0.65
137_P	140_E	1.045	0.65
74_N	107_S	1.041	0.65
103_L	164_Q	1.027	0.64
11_Y	14_F	1.023	0.64
102_M	163_L	1.013	0.63
85_E	155_R	1.009	0.63
162_E	177_P	1.005	0.62
90_D	189_T	1.004	0.62
83_R	159_S	1.002	0.62
85_E	121_P	0.996	0.62
28_L	156_V	0.992	0.61
66_L	80_F	0.983	0.61
176_L	184_Y	0.982	0.60
46_S	138_L	0.981	0.60
31_Q	79_N	0.975	0.60
27_P	76_D	0.969	0.59
79_N	194_G	0.961	0.59
73_Y	189_T	0.958	0.59
69_P	107_S	0.953	0.58
42_V	168_A	0.951	0.58
128_E	131_T	0.946	0.58
6_L	94_L	0.942	0.57
28_L	134_L	0.939	0.57
165_I	189_T	0.939	0.57
174_A	178_G	0.938	0.57
106_R	132_Q	0.938	0.57
114_R	192_V	0.938	0.57
15_Y	60_Y	0.929	0.56
21_P	168_A	0.929	0.56
15_Y	81_M	0.927	0.56
71_S	107_S	0.925	0.56
14_F	31_Q	0.923	0.56
61_D	99_R	0.922	0.56
60_Y	81_M	0.915	0.55
54_L	60_Y	0.912	0.55
3_L	14_F	0.910	0.55
109_L	123_L	0.907	0.54
39_Y	94_L	0.900	0.54
120_P	156_V	0.899	0.54
101_A	134_L	0.896	0.53
14_F	54_L	0.896	0.53
183_M	190_S	0.891	0.53
31_Q	81_M	0.888	0.53
69_P	102_M	0.887	0.53
78_G	105_Y	0.887	0.53
144_E	164_Q	0.887	0.53
12_G	19_I	0.878	0.52
118_F	161_R	0.878	0.52
113_L	119_S	0.874	0.52
5_W	18_Y	0.870	0.51
72_P	76_D	0.866	0.51
29_H	99_R	0.859	0.50
62_V	139_F	0.855	0.50
84_L	156_V	0.847	0.49
21_P	176_L	0.846	0.49
83_R	96_S	0.846	0.49
108_P	136_V	0.841	0.49
89_A	93_V	0.830	0.48
136_V	145_D	0.829	0.48
120_P	189_T	0.825	0.48
19_I	180_R	0.816	0.47
58_Q	174_A	0.813	0.47
122_L	130_E	0.803	0.46
95_A	114_R	0.803	0.46
44_L	169_S	0.793	0.45
191_F	194_G	0.788	0.44
44_L	146_R	0.786	0.44
35_C	154_A	0.785	0.44
110_V	130_E	0.785	0.44
7_S	179_L	0.778	0.44
102_M	134_L	0.777	0.44
101_A	164_Q	0.773	0.43
86_L	93_V	0.769	0.43
38_P	77_L	0.767	0.43
100_P	124_L	0.764	0.42
2_L	195_S	0.762	0.42
145_D	149_P	0.759	0.42
120_P	190_S	0.749	0.41
9_F	57_G	0.748	0.41
2_L	9_F	0.747	0.41
106_R	114_R	0.740	0.41
183_M	194_G	0.738	0.40
124_L	188_I	0.732	0.40
41_T	155_R	0.730	0.40
25_E	64_L	0.729	0.40
122_L	125_G	0.725	0.39
58_Q	68_L	0.724	0.39
148_S	165_I	0.722	0.39
71_S	105_Y	0.721	0.39
137_P	191_F	0.712	0.38
16_Y	19_I	0.705	0.38
73_Y	116_L	0.704	0.38
56_P	86_L	0.702	0.38
142_Y	191_F	0.698	0.37
23_S	138_L	0.698	0.37
72_P	99_R	0.694	0.37
124_L	141_N	0.692	0.37
64_L	134_L	0.690	0.37
42_V	84_L	0.687	0.36
58_Q	179_L	0.685	0.36
98_R	134_L	0.684	0.36
32_Y	69_P	0.684	0.36
70_E	82_V	0.678	0.36
54_L	193_V	0.675	0.35
37_F	136_V	0.673	0.35
111_R	168_A	0.668	0.35
174_A	183_M	0.667	0.35
66_L	155_R	0.667	0.35
29_H	54_L	0.659	0.34
119_S	191_F	0.655	0.34
172_I	184_Y	0.654	0.34
68_L	183_M	0.651	0.34
143_E	186_W	0.650	0.34
88_S	149_P	0.646	0.33
94_L	151_T	0.645	0.33
66_L	168_A	0.644	0.33
91_G	113_L	0.637	0.33
134_L	154_A	0.637	0.33
81_M	163_L	0.632	0.32
32_Y	83_R	0.630	0.32
109_L	117_L	0.630	0.32
125_G	193_V	0.629	0.32
83_R	134_L	0.629	0.32
120_P	187_P	0.627	0.32
70_E	79_N	0.627	0.32
72_P	75_R	0.625	0.32
124_L	158_L	0.625	0.32
93_V	145_D	0.625	0.32
32_Y	81_M	0.620	0.31
105_Y	196_S	0.618	0.31
176_L	180_R	0.617	0.31
76_D	196_S	0.616	0.31
6_L	126_L	0.616	0.31
115_T	166_Y	0.615	0.31
64_L	139_F	0.614	0.31
56_P	165_I	0.613	0.31
139_F	170_L	0.610	0.31
25_E	169_S	0.609	0.31
77_L	138_L	0.608	0.31
81_M	101_A	0.608	0.31
48_G	136_V	0.607	0.30
113_L	160_S	0.602	0.30
8_V	64_L	0.599	0.30
144_E	149_P	0.598	0.30
11_Y	174_A	0.598	0.30
9_F	183_M	0.595	0.30
63_S	135_T	0.595	0.30
121_P	163_L	0.594	0.30
142_Y	165_I	0.593	0.29
116_L	120_P	0.592	0.29
183_M	195_S	0.589	0.29
25_E	103_L	0.588	0.29
64_L	126_L	0.588	0.29
83_R	94_L	0.588	0.29
60_Y	174_A	0.580	0.29
12_G	155_R	0.579	0.29
133_T	156_V	0.577	0.28
120_P	179_L	0.577	0.28
135_T	168_A	0.576	0.28
121_P	126_L	0.576	0.28
174_A	180_R	0.574	0.28
136_V	164_Q	0.572	0.28
42_V	159_S	0.572	0.28
39_Y	136_V	0.572	0.28
107_S	121_P	0.567	0.28
139_F	167_S	0.566	0.28
32_Y	58_Q	0.564	0.27
70_E	186_W	0.563	0.27
72_P	109_L	0.563	0.27
38_P	80_F	0.557	0.27
124_L	133_T	0.557	0.27
11_Y	194_G	0.554	0.27
33_G	81_M	0.552	0.27
105_Y	174_A	0.551	0.27
53_V	131_T	0.549	0.27
105_Y	130_E	0.546	0.26
53_V	154_A	0.544	0.26
74_N	166_Y	0.544	0.26
40_A	158_L	0.543	0.26
42_V	148_S	0.542	0.26
8_V	14_F	0.540	0.26
94_L	146_R	0.540	0.26
16_Y	44_L	0.535	0.26
9_F	157_E	0.531	0.25
167_S	196_S	0.530	0.25
64_L	136_V	0.530	0.25
34_L	162_E	0.529	0.25
9_F	25_E	0.525	0.25
30_F	156_V	0.521	0.25
156_V	168_A	0.521	0.25
180_R	183_M	0.521	0.25
192_V	196_S	0.517	0.24
91_G	162_E	0.515	0.24
23_S	175_R	0.515	0.24
47_N	165_I	0.514	0.24
148_S	158_L	0.513	0.24
135_T	191_F	0.509	0.24
99_R	144_E	0.506	0.24
58_Q	69_P	0.505	0.24
78_G	103_L	0.503	0.24
74_N	105_Y	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3u0aA	4	0.4949	2	0.962	Contact Map
3mtxA	1	0.4495	1.7	0.963	Contact Map
3m7oA	3	0.4545	1.7	0.963	Contact Map
1c8uA	2	0.4848	1.7	0.964	Contact Map
3vq2C	1	0.4495	1.4	0.965	Contact Map
3webA	1	0.4545	1.4	0.965	Contact Map
4r9zA	2	0.4495	1.3	0.966	Contact Map
1ou9A	4	0.4545	1.3	0.966	Contact Map
1yfnA	2	0.4495	1.2	0.966	Contact Map
4kt0J	1	0.1162	1.2	0.967	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.