DiS_P_DiS - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DiS_P_DiS - Bacterial Peptidase A24 N-terminal domain

PFAM:	PF06750	Sequences: LLGLIIGSFLNVVIYRLPSIVRPRSHCPSCGHPIRWYDNIPVLSWLLLRGRCRYCGAPISPRYPLVELLTGLLFALVAWRF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	81 (80)
Sequences:	50794 (33108)
Seq/√Len:	3701.6
META:	0.936

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_H	54_Y	3.385	1.00
29_S	57_A	2.949	1.00
38_D	53_R	2.942	1.00
70_T	74_F	2.627	1.00
24_R	33_P	2.364	1.00
38_D	54_Y	2.258	1.00
35_R	38_D	2.253	1.00
38_D	48_L	2.155	1.00
6_I	10_L	2.006	1.00
4_L	71_G	1.879	1.00
35_R	54_Y	1.705	1.00
19_S	23_P	1.646	1.00
26_H	31_G	1.625	1.00
61_P	65_L	1.437	1.00
13_V	17_L	1.373	1.00
15_Y	28_P	1.366	1.00
32_H	38_D	1.316	1.00
20_I	23_P	1.278	1.00
19_S	22_R	1.274	1.00
61_P	64_P	1.249	1.00
75_A	79_W	1.219	1.00
42_V	64_P	1.205	1.00
9_F	20_I	1.198	1.00
32_H	35_R	1.185	1.00
34_I	54_Y	1.171	1.00
48_L	53_R	1.164	1.00
57_A	60_S	1.138	1.00
3_G	71_G	1.133	1.00
10_L	70_T	1.126	1.00
11_N	66_V	1.116	1.00
7_G	70_T	1.114	1.00
27_C	30_C	1.109	1.00
77_V	80_R	1.103	1.00
10_L	14_I	1.062	1.00
28_P	59_I	1.033	1.00
44_S	47_L	1.024	1.00
62_R	66_V	1.020	1.00
44_S	48_L	1.017	1.00
74_F	77_V	1.008	1.00
60_S	63_Y	1.003	1.00
26_H	33_P	0.995	1.00
6_I	74_F	0.993	1.00
14_I	66_V	0.991	1.00
45_W	61_P	0.978	1.00
3_G	74_F	0.974	1.00
52_C	55_C	0.973	1.00
28_P	63_Y	0.970	1.00
74_F	78_A	0.958	1.00
23_P	26_H	0.943	1.00
4_L	42_V	0.936	1.00
71_G	75_A	0.933	1.00
34_I	39_N	0.929	1.00
43_L	47_L	0.908	1.00
12_V	15_Y	0.897	1.00
46_L	64_P	0.894	1.00
35_R	53_R	0.889	1.00
58_P	61_P	0.883	1.00
76_L	80_R	0.882	1.00
11_N	62_R	0.876	1.00
49_R	56_G	0.864	1.00
15_Y	26_H	0.860	1.00
30_C	55_C	0.859	1.00
64_P	68_L	0.854	1.00
45_W	50_G	0.852	1.00
8_S	25_S	0.850	1.00
65_L	69_L	0.849	1.00
14_I	18_P	0.844	1.00
15_Y	62_R	0.844	1.00
66_V	70_T	0.826	1.00
37_Y	47_L	0.811	1.00
2_L	6_I	0.809	1.00
11_N	14_I	0.804	1.00
34_I	38_D	0.795	1.00
73_L	77_V	0.761	1.00
14_I	62_R	0.760	1.00
42_V	68_L	0.741	1.00
11_N	15_Y	0.732	1.00
70_T	73_L	0.729	1.00
72_L	76_L	0.725	1.00
15_Y	63_Y	0.723	1.00
38_D	44_S	0.721	1.00
16_R	23_P	0.713	1.00
59_I	64_P	0.700	1.00
45_W	59_I	0.689	1.00
37_Y	53_R	0.687	1.00
2_L	5_I	0.677	1.00
30_C	52_C	0.677	1.00
68_L	72_L	0.670	1.00
24_R	36_W	0.668	1.00
69_L	72_L	0.667	1.00
52_C	57_A	0.664	1.00
72_L	75_A	0.662	1.00
69_L	73_L	0.660	1.00
12_V	18_P	0.651	1.00
27_C	55_C	0.641	1.00
25_S	39_N	0.640	1.00
62_R	65_L	0.622	1.00
13_V	20_I	0.612	1.00
13_V	18_P	0.609	1.00
22_R	26_H	0.605	1.00
8_S	39_N	0.595	1.00
42_V	46_L	0.585	1.00
76_L	79_W	0.582	1.00
45_W	64_P	0.574	1.00
75_A	78_A	0.574	1.00
1_L	4_L	0.563	1.00
40_I	43_L	0.556	1.00
1_L	5_I	0.554	1.00
36_W	39_N	0.553	1.00
70_T	77_V	0.541	1.00
25_S	41_P	0.539	1.00
15_Y	18_P	0.534	1.00
28_P	57_A	0.523	1.00
19_S	26_H	0.517	1.00
4_L	64_P	0.516	1.00
32_H	53_R	0.513	1.00
21_V	26_H	0.511	1.00
51_R	58_P	0.506	1.00
4_L	7_G	0.505	1.00
27_C	52_C	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2lcqA	1	0.6543	44.5	0.836	Contact Map
2fiyA	1	0.9753	38.1	0.842	Contact Map
2ct0A	1	0.7654	26.7	0.854	Contact Map
1vq8Z	1	0.8642	23.2	0.858	Contact Map
3py7A	1	0.642	20.2	0.863	Contact Map
1iymA	1	0.5185	18.8	0.864	Contact Map
4l2nA	2	0.7778	15.9	0.869	Contact Map
3nw0A	1	0.8642	13.2	0.873	Contact Map
2qkdA	2	0.7037	12.5	0.875	Contact Map
2l0bA	1	0.7778	12.2	0.875	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.