DUF1192 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1192 - Protein of unknown function (DUF1192)

PFAM:	PF06698	Sequences: DDDEPRKKPAHEIGQDLDLLSVEELEERIALLEAEIARLEAAIAAKQAHRSAADALFK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	58 (58)
Sequences:	7417 (3895)
Seq/√Len:	511.4
META:	0.945

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_E	40_E	4.483	1.00
26_E	43_I	2.767	1.00
42_A	45_A	2.312	1.00
26_E	47_Q	2.259	1.00
51_S	54_D	2.003	1.00
15_Q	28_R	1.830	1.00
33_E	37_A	1.697	1.00
28_R	39_L	1.695	1.00
22_V	26_E	1.627	1.00
29_I	36_I	1.620	1.00
49_H	56_L	1.595	1.00
18_D	42_A	1.554	1.00
41_A	44_A	1.499	1.00
30_A	33_E	1.474	1.00
37_A	40_E	1.466	1.00
21_S	24_E	1.458	1.00
50_R	54_D	1.428	1.00
30_A	34_A	1.404	1.00
23_E	26_E	1.370	1.00
16_D	19_L	1.267	1.00
22_V	46_K	1.235	1.00
42_A	46_K	1.226	1.00
29_I	40_E	1.121	1.00
27_E	30_A	1.089	1.00
12_E	15_Q	1.065	1.00
22_V	43_I	1.058	1.00
35_E	38_R	1.044	1.00
47_Q	51_S	1.023	1.00
25_L	39_L	1.017	1.00
15_Q	20_L	0.983	1.00
37_A	41_A	0.975	1.00
46_K	49_H	0.972	1.00
44_A	47_Q	0.950	1.00
33_E	36_I	0.945	1.00
43_I	47_Q	0.939	1.00
11_H	28_R	0.926	1.00
34_A	37_A	0.887	1.00
26_E	40_E	0.886	1.00
44_A	48_A	0.873	1.00
29_I	33_E	0.831	1.00
48_A	52_A	0.810	1.00
11_H	14_G	0.796	1.00
13_I	31_L	0.795	1.00
47_Q	50_R	0.789	1.00
6_R	9_P	0.783	1.00
23_E	27_E	0.773	1.00
25_L	43_I	0.762	1.00
41_A	45_A	0.762	1.00
29_I	39_L	0.761	1.00
11_H	39_L	0.747	1.00
1_D	6_R	0.719	1.00
52_A	55_A	0.716	1.00
39_L	42_A	0.713	1.00
9_P	12_E	0.713	1.00
40_E	44_A	0.711	1.00
22_V	47_Q	0.691	1.00
20_L	31_L	0.691	1.00
17_L	46_K	0.691	1.00
4_E	9_P	0.687	1.00
3_D	6_R	0.665	1.00
37_A	44_A	0.662	1.00
4_E	7_K	0.647	1.00
45_A	49_H	0.644	1.00
34_A	41_A	0.634	1.00
26_E	30_A	0.632	1.00
49_H	53_A	0.630	1.00
17_L	38_R	0.623	1.00
55_A	58_K	0.620	1.00
14_G	39_L	0.604	1.00
13_I	16_D	0.587	0.99
53_A	56_L	0.582	0.99
22_V	50_R	0.571	0.99
17_L	32_L	0.559	0.99
10_A	31_L	0.557	0.99
29_I	43_I	0.557	0.99
3_D	8_K	0.554	0.99
19_L	49_H	0.545	0.99
27_E	31_L	0.529	0.99
18_D	45_A	0.524	0.99
30_A	37_A	0.522	0.99
24_E	49_H	0.521	0.99
47_Q	52_A	0.519	0.98
45_A	48_A	0.515	0.98
19_L	24_E	0.514	0.98
1_D	5_P	0.512	0.98
25_L	28_R	0.506	0.98
32_L	39_L	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4tp9Y	1	0.7241	21	0.818	Contact Map
1vx73	1	0.7931	19.6	0.821	Contact Map
2idbA	3	0.6379	18.4	0.823	Contact Map
3wpaA	3	0	18.2	0.823	Contact Map
2wq1A	3	0.4655	17.1	0.826	Contact Map
1r73A	1	0.7069	16.9	0.826	Contact Map
3j60g	1	0.6897	16.6	0.826	Contact Map
2zjrV	1	0.6897	16.3	0.827	Contact Map
4cr2M	1	0.3966	16.1	0.828	Contact Map
4etpA	1	0.6379	16	0.828	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.