DUF1190 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1190 - Protein of unknown function (DUF1190)

PFAM:	PF06693	Sequences: DEDAAVYTSVDECVAAGPFSAEQCEAAYAEALAEHARTAPRYASRADCEAEFGAGQCQQAQQTSGGGSFFMPLMAGFMMGRMLSGGGGYASQPLYRSRDGGSTYPGGSGYVTASGRSYGSASGGGRTVRVPKSAVKPPPTRTSTVSRGGFGSSASARSSWG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	161 (155)
Sequences:	1056 (827)
Seq/√Len:	66.4
META:	0.597

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_E	37_R	4.348	1.00
77_F	81_R	3.923	1.00
28_Y	32_L	3.580	1.00
73_L	80_G	3.454	1.00
7_Y	16_A	3.339	1.00
25_E	29_A	3.303	1.00
8_T	12_E	3.200	1.00
42_Y	51_E	3.160	1.00
73_L	77_F	3.150	1.00
10_V	14_V	2.938	1.00
14_V	25_E	2.887	1.00
69_F	73_L	2.566	1.00
35_H	95_Y	2.317	1.00
21_A	25_E	2.311	1.00
9_S	12_E	2.209	1.00
71_M	78_M	2.200	1.00
20_S	23_Q	2.143	1.00
112_T	118_Y	2.118	1.00
29_A	32_L	1.870	1.00
75_A	79_M	1.859	1.00
14_V	21_A	1.796	1.00
43_A	46_A	1.752	1.00
11_D	15_A	1.720	1.00
71_M	82_M	1.673	0.99
33_A	36_A	1.658	0.99
30_E	34_E	1.652	0.99
139_P	142_T	1.627	0.99
75_A	78_M	1.606	0.99
144_T	147_R	1.585	0.99
73_L	82_M	1.536	0.99
44_S	47_D	1.532	0.99
42_Y	52_F	1.507	0.99
22_E	25_E	1.494	0.99
46_A	50_A	1.473	0.98
6_V	94_L	1.457	0.98
72_P	77_F	1.416	0.98
49_E	55_G	1.398	0.98
49_E	53_G	1.397	0.98
7_Y	19_F	1.384	0.98
104_Y	107_G	1.369	0.98
34_E	38_T	1.293	0.97
126_R	130_V	1.286	0.96
60_A	63_T	1.272	0.96
7_Y	17_G	1.264	0.96
47_D	51_E	1.262	0.96
70_F	73_L	1.260	0.96
147_R	154_A	1.255	0.96
47_D	50_A	1.253	0.96
49_E	70_F	1.252	0.96
35_H	39_A	1.203	0.95
70_F	76_G	1.194	0.95
152_S	156_A	1.189	0.94
41_R	53_G	1.186	0.94
77_F	83_L	1.183	0.94
95_Y	98_R	1.177	0.94
143_S	148_G	1.163	0.94
42_Y	148_G	1.149	0.93
80_G	154_A	1.146	0.93
43_A	47_D	1.141	0.93
9_S	113_A	1.110	0.92
53_G	72_P	1.105	0.92
138_P	141_R	1.078	0.91
42_Y	152_S	1.067	0.90
119_G	123_G	1.047	0.90
123_G	126_R	1.046	0.90
77_F	142_T	1.036	0.89
153_S	157_R	1.002	0.87
36_A	42_Y	0.995	0.87
152_S	155_S	0.993	0.87
23_Q	132_K	0.985	0.87
99_D	102_S	0.976	0.86
111_V	118_Y	0.957	0.85
7_Y	81_R	0.945	0.84
45_R	49_E	0.939	0.84
3_D	32_L	0.932	0.83
141_R	148_G	0.917	0.82
13_C	24_C	0.916	0.82
69_F	75_A	0.915	0.82
12_E	16_A	0.911	0.82
124_G	127_T	0.906	0.82
120_S	123_G	0.903	0.81
119_G	124_G	0.900	0.81
115_G	121_A	0.898	0.81
53_G	71_M	0.896	0.81
76_G	83_L	0.894	0.81
67_G	78_M	0.894	0.81
107_G	110_Y	0.873	0.79
53_G	56_Q	0.866	0.79
11_D	14_V	0.866	0.79
73_L	83_L	0.860	0.78
81_R	86_G	0.857	0.78
5_A	16_A	0.848	0.77
115_G	118_Y	0.841	0.77
142_T	157_R	0.839	0.76
52_F	154_A	0.838	0.76
80_G	84_S	0.835	0.76
113_A	119_G	0.830	0.76
74_M	91_S	0.816	0.74
120_S	125_G	0.814	0.74
4_A	10_V	0.813	0.74
47_D	52_F	0.811	0.74
75_A	91_S	0.804	0.73
80_G	83_L	0.801	0.73
88_G	152_S	0.800	0.73
17_G	21_A	0.797	0.73
26_A	29_A	0.794	0.72
7_Y	92_Q	0.793	0.72
102_S	105_P	0.792	0.72
22_E	26_A	0.786	0.72
53_G	78_M	0.781	0.71
140_T	144_T	0.777	0.71
74_M	82_M	0.768	0.70
23_Q	42_Y	0.767	0.70
38_T	94_L	0.759	0.69
42_Y	53_G	0.759	0.69
147_R	150_F	0.754	0.68
44_S	50_A	0.752	0.68
40_P	76_G	0.748	0.68
53_G	70_F	0.745	0.67
127_T	133_S	0.744	0.67
68_S	73_L	0.729	0.66
36_A	58_Q	0.722	0.65
145_V	152_S	0.720	0.65
63_T	66_G	0.716	0.64
42_Y	134_A	0.716	0.64
137_P	153_S	0.715	0.64
7_Y	12_E	0.715	0.64
141_R	145_V	0.708	0.64
66_G	70_F	0.708	0.64
119_G	126_R	0.707	0.63
38_T	51_E	0.705	0.63
122_S	125_G	0.705	0.63
11_D	25_E	0.705	0.63
139_P	144_T	0.697	0.62
21_A	56_Q	0.695	0.62
67_G	77_F	0.692	0.62
22_E	125_G	0.691	0.62
85_G	88_G	0.688	0.61
104_Y	110_Y	0.687	0.61
116_R	134_A	0.680	0.60
129_R	132_K	0.677	0.60
73_L	81_R	0.676	0.60
74_M	79_M	0.675	0.60
40_P	52_F	0.672	0.59
35_H	77_F	0.672	0.59
52_F	145_V	0.672	0.59
41_R	47_D	0.671	0.59
19_F	23_Q	0.670	0.59
131_P	134_A	0.663	0.58
97_S	101_G	0.659	0.58
46_A	49_E	0.656	0.58
48_C	57_C	0.655	0.58
19_F	49_E	0.653	0.57
126_R	129_R	0.651	0.57
23_Q	79_M	0.650	0.57
68_S	75_A	0.645	0.56
41_R	45_R	0.645	0.56
102_S	107_G	0.644	0.56
55_G	58_Q	0.641	0.56
127_T	130_V	0.631	0.55
93_P	112_T	0.627	0.54
78_M	93_P	0.627	0.54
77_F	143_S	0.626	0.54
122_S	127_T	0.626	0.54
69_F	79_M	0.625	0.54
55_G	111_V	0.623	0.54
104_Y	111_V	0.621	0.54
107_G	152_S	0.619	0.53
91_S	120_S	0.618	0.53
61_Q	86_G	0.618	0.53
86_G	131_P	0.617	0.53
101_G	105_P	0.615	0.53
14_V	27_A	0.615	0.53
71_M	83_L	0.609	0.52
24_C	48_C	0.605	0.52
100_G	103_T	0.603	0.51
110_Y	118_Y	0.602	0.51
142_T	153_S	0.596	0.51
103_T	106_G	0.595	0.51
96_R	99_D	0.594	0.50
60_A	66_G	0.592	0.50
119_G	127_T	0.586	0.49
35_H	52_F	0.585	0.49
87_G	101_G	0.583	0.49
107_G	117_S	0.578	0.49
99_D	103_T	0.571	0.48
62_Q	65_G	0.570	0.48
43_A	82_M	0.570	0.48
4_A	9_S	0.565	0.47
116_R	124_G	0.562	0.47
139_P	148_G	0.562	0.47
140_T	148_G	0.559	0.46
92_Q	97_S	0.558	0.46
8_T	145_V	0.553	0.46
90_A	137_P	0.552	0.45
16_A	91_S	0.551	0.45
6_V	16_A	0.549	0.45
64_S	67_G	0.546	0.45
61_Q	66_G	0.545	0.45
139_P	143_S	0.545	0.45
46_A	128_V	0.544	0.45
19_F	35_H	0.544	0.45
45_R	85_G	0.543	0.44
100_G	104_Y	0.536	0.44
70_F	141_R	0.532	0.43
60_A	77_F	0.532	0.43
59_Q	63_T	0.530	0.43
122_S	126_R	0.530	0.43
32_L	37_R	0.528	0.43
36_A	137_P	0.528	0.43
82_M	85_G	0.527	0.43
98_R	101_G	0.526	0.42
123_G	131_P	0.526	0.42
31_A	94_L	0.523	0.42
6_V	78_M	0.523	0.42
100_G	105_P	0.518	0.41
111_V	115_G	0.518	0.41
112_T	116_R	0.516	0.41
83_L	158_S	0.514	0.41
74_M	81_R	0.512	0.41
19_F	153_S	0.512	0.41
118_Y	133_S	0.511	0.41
14_V	17_G	0.511	0.41
121_A	124_G	0.511	0.41
74_M	78_M	0.510	0.41
115_G	137_P	0.508	0.40
13_C	48_C	0.507	0.40
112_T	117_S	0.507	0.40
11_D	22_E	0.505	0.40
78_M	142_T	0.505	0.40
81_R	95_Y	0.502	0.40
156_A	159_S	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2mi9A	1	0.1863	3.4	0.951	Contact Map
2kziA	1	0.2547	2.8	0.953	Contact Map
4lu2A	2	0.2857	2.7	0.953	Contact Map
1elwA	1	0.4969	2.6	0.954	Contact Map
3q8iA	2	0.2795	2.4	0.955	Contact Map
1na3A	1	0.5031	2.3	0.955	Contact Map
3r72A	1	0.2733	2.1	0.956	Contact Map
1oohA	1	0.2795	2	0.957	Contact Map
2lniA	1	0.5155	1.8	0.958	Contact Map
1r7lA	2	0.2236	1.7	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.