DUF1168 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1168 - Protein of unknown function (DUF1168)

PFAM:	PF06658	Sequences: PDKPVPIPEPPKEKTPRPPPEFVRNVQGSSAGAGSGEFHVYRASRRREYERLKLMDEEAEKEKEDEEFEKKREERKKAAEEKTAKNRAKRQKKKQKKKKKKKAKKGKEEEEEEEEDSSDSDEDSDEEEEEEEEEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	135 (126)
Sequences:	564 (429)
Seq/√Len:	38.2
META:	0.204

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
73_E	77_K	4.242	1.00
66_E	70_K	3.664	1.00
84_A	88_A	3.350	1.00
60_E	64_E	2.981	1.00
88_A	91_Q	2.699	1.00
74_E	78_A	2.685	1.00
72_R	76_K	2.594	1.00
63_K	67_E	2.568	1.00
27_Q	37_E	2.389	1.00
76_K	80_E	2.385	1.00
67_E	71_K	2.360	1.00
53_K	57_E	2.314	1.00
52_L	56_D	2.150	0.99
71_K	75_R	2.035	0.99
77_K	81_E	1.995	0.99
42_R	86_N	1.943	0.98
44_S	47_R	1.934	0.98
87_R	91_Q	1.909	0.98
27_Q	43_A	1.900	0.98
20_P	23_V	1.824	0.98
73_E	76_K	1.814	0.97
12_K	15_T	1.703	0.96
72_R	75_R	1.575	0.94
59_A	63_K	1.569	0.94
96_K	99_K	1.510	0.93
110_E	117_S	1.455	0.91
2_D	10_P	1.427	0.91
23_V	26_V	1.412	0.90
16_P	19_P	1.400	0.90
70_K	74_E	1.341	0.88
99_K	102_K	1.326	0.87
27_Q	42_R	1.305	0.86
55_M	80_E	1.284	0.85
122_E	126_E	1.265	0.84
27_Q	44_S	1.264	0.84
37_E	43_A	1.221	0.82
84_A	91_Q	1.215	0.82
50_E	55_M	1.206	0.81
11_P	15_T	1.179	0.80
82_K	86_N	1.170	0.79
22_F	27_Q	1.169	0.79
117_S	120_S	1.155	0.79
33_A	37_E	1.154	0.79
37_E	40_V	1.152	0.78
84_A	87_R	1.147	0.78
69_E	72_R	1.142	0.78
84_A	94_K	1.141	0.78
79_A	83_T	1.139	0.78
36_G	40_V	1.131	0.77
36_G	46_R	1.120	0.76
31_A	38_F	1.063	0.73
116_D	122_E	1.063	0.73
32_G	36_G	1.062	0.72
29_S	39_H	1.058	0.72
35_S	51_R	1.052	0.72
43_A	47_R	1.052	0.72
40_V	49_Y	1.029	0.70
27_Q	36_G	1.025	0.70
68_F	72_R	1.023	0.70
121_D	125_D	1.015	0.69
119_D	125_D	1.008	0.68
26_V	55_M	1.006	0.68
36_G	39_H	1.003	0.68
61_K	65_D	0.994	0.67
20_P	81_E	0.993	0.67
13_E	61_K	0.990	0.67
105_K	109_E	0.990	0.67
65_D	69_E	0.982	0.66
46_R	49_Y	0.979	0.66
121_D	124_S	0.967	0.65
105_K	108_E	0.937	0.63
95_Q	100_K	0.920	0.61
95_Q	101_K	0.919	0.61
14_K	25_N	0.912	0.61
60_E	65_D	0.911	0.60
32_G	41_Y	0.910	0.60
23_V	31_A	0.908	0.60
36_G	43_A	0.892	0.59
52_L	75_R	0.887	0.58
36_G	41_Y	0.883	0.58
124_S	127_E	0.882	0.58
20_P	39_H	0.854	0.56
111_E	114_E	0.852	0.55
99_K	103_A	0.841	0.54
104_K	108_E	0.838	0.54
22_F	42_R	0.831	0.53
78_A	82_K	0.829	0.53
111_E	115_E	0.823	0.53
40_V	53_K	0.816	0.52
30_S	50_E	0.815	0.52
24_R	42_R	0.813	0.52
37_E	44_S	0.795	0.50
40_V	57_E	0.793	0.50
10_P	101_K	0.786	0.49
112_E	115_E	0.778	0.49
20_P	24_R	0.775	0.48
6_P	9_E	0.774	0.48
118_S	125_D	0.768	0.48
27_Q	40_V	0.767	0.48
117_S	121_D	0.761	0.47
120_S	125_D	0.760	0.47
38_F	46_R	0.755	0.47
83_T	87_R	0.752	0.46
109_E	114_E	0.749	0.46
23_V	67_E	0.744	0.46
2_D	93_K	0.744	0.46
26_V	46_R	0.727	0.44
119_D	123_D	0.727	0.44
15_T	54_L	0.720	0.44
119_D	122_E	0.720	0.44
64_E	89_K	0.719	0.43
118_S	121_D	0.719	0.43
75_R	79_A	0.717	0.43
32_G	40_V	0.713	0.43
11_P	61_K	0.703	0.42
68_F	71_K	0.702	0.42
74_E	77_K	0.697	0.42
109_E	124_S	0.697	0.42
25_N	50_E	0.689	0.41
89_K	93_K	0.681	0.40
39_H	46_R	0.675	0.40
2_D	7_I	0.672	0.39
113_E	123_D	0.670	0.39
27_Q	32_G	0.664	0.39
118_S	122_E	0.663	0.39
55_M	58_E	0.662	0.39
95_Q	98_K	0.661	0.38
110_E	113_E	0.648	0.37
116_D	121_D	0.648	0.37
16_P	54_L	0.646	0.37
9_E	12_K	0.643	0.37
75_R	94_K	0.639	0.37
15_T	82_K	0.636	0.36
37_E	42_R	0.635	0.36
106_G	111_E	0.629	0.36
107_K	112_E	0.628	0.36
3_K	56_D	0.624	0.35
93_K	96_K	0.623	0.35
22_F	79_A	0.623	0.35
79_A	94_K	0.616	0.35
120_S	124_S	0.616	0.35
24_R	44_S	0.615	0.35
114_E	117_S	0.609	0.34
69_E	73_E	0.609	0.34
57_E	67_E	0.603	0.34
122_E	125_D	0.603	0.34
36_G	47_R	0.602	0.34
103_A	106_G	0.600	0.33
8_P	80_E	0.598	0.33
115_E	126_E	0.591	0.33
117_S	124_S	0.591	0.33
103_A	111_E	0.590	0.33
22_F	59_A	0.588	0.32
7_I	13_E	0.575	0.31
95_Q	105_K	0.570	0.31
31_A	35_S	0.568	0.31
21_E	33_A	0.568	0.31
107_K	122_E	0.567	0.31
99_K	108_E	0.565	0.31
41_Y	51_R	0.564	0.31
100_K	104_K	0.563	0.31
5_V	59_A	0.560	0.30
113_E	116_D	0.555	0.30
29_S	40_V	0.552	0.30
108_E	116_D	0.545	0.29
101_K	116_D	0.541	0.29
27_Q	46_R	0.541	0.29
63_K	68_F	0.540	0.29
64_E	104_K	0.538	0.29
40_V	43_A	0.535	0.28
10_P	13_E	0.535	0.28
28_G	35_S	0.534	0.28
108_E	115_E	0.532	0.28
81_E	84_A	0.527	0.28
4_P	59_A	0.519	0.27
123_D	127_E	0.518	0.27
5_V	91_Q	0.517	0.27
28_G	51_R	0.513	0.27
6_P	14_K	0.512	0.27
42_R	50_E	0.512	0.27
50_E	53_K	0.509	0.27
57_E	61_K	0.507	0.26
102_K	105_K	0.505	0.26
32_G	35_S	0.504	0.26
30_S	87_R	0.504	0.26
54_L	68_F	0.504	0.26
11_P	16_P	0.503	0.26
38_F	47_R	0.501	0.26
30_S	92_K	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kt5C	1	0.0519	8.2	0.938	Contact Map
4u7aA	1	0	6.1	0.941	Contact Map
4m9qA	1	0.5407	4.4	0.945	Contact Map
4mtlA	4	0.3556	4.1	0.946	Contact Map
2mpwA	1	0.3185	4.1	0.946	Contact Map
5a21C	2	0.3333	3.7	0.947	Contact Map
4whtA	2	0.0444	3.5	0.948	Contact Map
3ziaJ	1	0.237	3.1	0.949	Contact Map
4c2m3	1	0.2667	3	0.949	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.