DUF1150 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1150 - Protein of unknown function (DUF1150)

PFAM:	PF06620	Sequences: LTPEAFAALGGGRIAYVRPVRSEDLPRLFPQAPQLPPGLTLFALHAADGTPLALTDSREAAFANARQNDLEPVSVH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	76 (75)
Sequences:	3473 (2010)
Seq/√Len:	232.0
META:	0.912

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_P	40_T	3.304	1.00
58_R	62_F	2.351	1.00
46_A	50_T	2.221	1.00
44_L	65_A	2.133	1.00
21_R	40_T	2.035	1.00
21_R	24_D	2.006	1.00
63_A	67_Q	1.999	1.00
57_S	60_A	1.943	1.00
66_R	72_P	1.932	1.00
46_A	52_L	1.852	1.00
18_R	51_P	1.845	1.00
6_F	9_L	1.801	1.00
55_T	61_A	1.747	1.00
22_S	38_G	1.632	1.00
5_A	8_A	1.584	1.00
7_A	10_G	1.547	1.00
62_F	66_R	1.532	1.00
64_N	68_N	1.403	1.00
23_E	38_G	1.401	1.00
8_A	11_G	1.384	1.00
4_E	8_A	1.367	1.00
53_A	64_N	1.349	1.00
17_V	72_P	1.332	1.00
6_F	10_G	1.324	1.00
26_P	34_Q	1.318	1.00
22_S	35_L	1.312	1.00
68_N	72_P	1.234	1.00
13_R	71_E	1.112	1.00
42_F	61_A	1.100	1.00
20_V	25_L	1.083	1.00
13_R	70_L	1.068	1.00
17_V	61_A	1.051	1.00
62_F	71_E	1.050	1.00
29_F	32_A	1.041	1.00
17_V	42_F	1.033	1.00
64_N	72_P	1.022	1.00
44_L	64_N	0.993	1.00
55_T	60_A	0.988	1.00
2_T	5_A	0.979	1.00
8_A	13_R	0.974	1.00
22_S	39_L	0.956	1.00
9_L	47_A	0.952	1.00
16_Y	65_A	0.950	1.00
52_L	65_A	0.937	1.00
44_L	55_T	0.934	1.00
35_L	41_L	0.927	1.00
10_G	47_A	0.926	1.00
11_G	14_I	0.903	0.99
3_P	6_F	0.901	0.99
27_R	32_A	0.875	0.99
15_A	44_L	0.871	0.99
31_Q	53_A	0.869	0.99
58_R	74_S	0.865	0.99
21_R	39_L	0.854	0.99
19_P	74_S	0.853	0.99
53_A	61_A	0.850	0.99
15_A	70_L	0.825	0.99
26_P	31_Q	0.816	0.99
16_Y	45_H	0.815	0.99
12_G	47_A	0.814	0.99
25_L	33_P	0.812	0.99
66_R	71_E	0.805	0.99
35_L	38_G	0.802	0.99
41_L	65_A	0.802	0.99
45_H	51_P	0.796	0.99
25_L	54_L	0.789	0.99
44_L	70_L	0.783	0.99
17_V	62_F	0.739	0.98
16_Y	61_A	0.739	0.98
50_T	56_D	0.736	0.98
62_F	72_P	0.735	0.98
29_F	54_L	0.734	0.98
63_A	66_R	0.731	0.98
14_I	51_P	0.719	0.97
43_A	54_L	0.717	0.97
11_G	48_D	0.715	0.97
32_A	37_P	0.713	0.97
10_G	46_A	0.712	0.97
20_V	28_L	0.701	0.97
42_F	45_H	0.688	0.97
20_V	54_L	0.687	0.97
24_D	27_R	0.686	0.97
42_F	55_T	0.675	0.96
66_R	69_D	0.664	0.96
55_T	64_N	0.653	0.96
65_A	73_V	0.648	0.95
11_G	65_A	0.638	0.95
33_P	36_P	0.638	0.95
32_A	35_L	0.632	0.95
4_E	53_A	0.628	0.95
67_Q	72_P	0.625	0.94
19_P	42_F	0.620	0.94
60_A	64_N	0.617	0.94
20_V	43_A	0.617	0.94
10_G	59_E	0.610	0.94
43_A	51_P	0.603	0.93
31_Q	34_Q	0.600	0.93
59_E	63_A	0.583	0.92
5_A	27_R	0.581	0.92
3_P	52_L	0.579	0.92
25_L	31_Q	0.577	0.92
68_N	73_V	0.564	0.91
15_A	25_L	0.553	0.90
27_R	33_P	0.540	0.89
46_A	70_L	0.535	0.88
18_R	71_E	0.530	0.88
11_G	52_L	0.530	0.88
18_R	38_G	0.518	0.87
25_L	32_A	0.517	0.87
35_L	73_V	0.506	0.86
36_P	48_D	0.502	0.85
42_F	53_A	0.500	0.85

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4oi3A	2	0.8289	30.4	0.859	Contact Map
1vbiA	2	0.9605	22.7	0.868	Contact Map
1wtjA	2	0.9737	22.6	0.868	Contact Map
2x06A	2	0.9737	21.1	0.87	Contact Map
2g8yA	2	0.9737	19.1	0.872	Contact Map
1v9nA	2	0.9737	18.7	0.873	Contact Map
3i0pA	2	0.9737	17.4	0.874	Contact Map
1z2iA	2	0.9737	15.9	0.877	Contact Map
4h8aA	2	0.9737	15.8	0.877	Contact Map
3uoeA	2	0.9737	15.8	0.877	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.