DUF1145 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1145 - Protein of unknown function (DUF1145)

PFAM:	PF06611	Sequences: MLIGLGKLLTLLFWLVVLLNLFHPFPGPLALLLNLAGAFLLLMHLLELLLFKGKLKGD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	58 (56)
Sequences:	713 (401)
Seq/√Len:	53.6
META:	0.628

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_V	37_G	4.765	1.00
20_N	24_P	4.041	1.00
11_L	15_L	2.657	1.00
20_N	23_H	1.927	1.00
16_V	33_L	1.870	0.99
37_G	41_L	1.838	0.99
13_F	37_G	1.767	0.99
20_N	34_N	1.651	0.99
6_G	10_T	1.463	0.97
43_M	47_E	1.458	0.97
27_G	30_A	1.455	0.97
25_F	30_A	1.438	0.96
34_N	38_A	1.390	0.96
20_N	25_F	1.386	0.96
2_L	7_K	1.350	0.95
45_L	49_L	1.341	0.95
28_P	36_A	1.338	0.95
46_L	50_L	1.332	0.95
25_F	33_L	1.233	0.92
28_P	39_F	1.206	0.91
51_F	57_G	1.119	0.87
11_L	22_F	1.103	0.87
9_L	15_L	1.065	0.85
33_L	51_F	1.046	0.84
12_L	49_L	1.038	0.83
17_V	40_L	1.019	0.82
52_K	56_K	1.016	0.82
13_F	17_V	0.971	0.79
42_L	50_L	0.959	0.78
32_L	39_F	0.945	0.77
10_T	40_L	0.941	0.77
5_L	8_L	0.940	0.77
31_L	34_N	0.933	0.76
33_L	37_G	0.888	0.72
13_F	41_L	0.884	0.72
37_G	47_E	0.874	0.71
3_I	39_F	0.873	0.71
35_L	40_L	0.871	0.71
8_L	25_F	0.870	0.71
22_F	27_G	0.849	0.69
32_L	36_A	0.836	0.68
13_F	40_L	0.806	0.65
31_L	39_F	0.803	0.65
8_L	12_L	0.750	0.59
6_G	16_V	0.749	0.59
21_L	31_L	0.748	0.59
13_F	47_E	0.739	0.58
47_E	54_K	0.729	0.57
4_G	39_F	0.725	0.57
38_A	42_L	0.712	0.55
3_I	53_G	0.705	0.55
26_P	35_L	0.696	0.54
11_L	26_P	0.686	0.53
5_L	18_L	0.685	0.52
18_L	21_L	0.680	0.52
49_L	53_G	0.677	0.52
13_F	33_L	0.673	0.51
7_K	40_L	0.664	0.50
29_L	48_L	0.661	0.50
5_L	16_V	0.644	0.48
46_L	53_G	0.644	0.48
15_L	35_L	0.633	0.47
11_L	23_H	0.618	0.45
10_T	13_F	0.612	0.45
19_L	26_P	0.611	0.45
34_N	45_L	0.602	0.44
48_L	56_K	0.600	0.43
54_K	57_G	0.596	0.43
3_I	38_A	0.593	0.43
36_A	55_L	0.577	0.41
12_L	19_L	0.562	0.40
31_L	35_L	0.555	0.39
12_L	16_V	0.554	0.39
2_L	12_L	0.552	0.39
3_I	11_L	0.547	0.38
35_L	47_E	0.534	0.37
26_P	41_L	0.531	0.36
17_V	48_L	0.530	0.36
17_V	47_E	0.528	0.36
11_L	55_L	0.517	0.35
23_H	27_G	0.515	0.35
2_L	53_G	0.509	0.34
2_L	46_L	0.502	0.34
7_K	44_H	0.500	0.33

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4lidA	3	0.2414	1.4	0.889	Contact Map
4mndA	2	0.931	1.4	0.89	Contact Map
4e6zA	1	0	1.2	0.893	Contact Map
4gbaF	1	0.1379	0.8	0.906	Contact Map
4u0cA	3	0.6552	0.7	0.91	Contact Map
2b2hA	3	0.5862	0.7	0.91	Contact Map
2kncA	1	0.7241	0.7	0.91	Contact Map
4p6vB	1	0.931	0.7	0.911	Contact Map
2xdeA	1	0.6552	0.7	0.912	Contact Map
1jb0K	1	0.2931	0.6	0.912	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.004 seconds.