DUF1134 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1134 - Protein of unknown function (DUF1134)

PFAM:	PF06577	Sequences: DTYSEDEIVDAGHGFFGKTSEGLASVIEKAFSDQGRPNGYILGEEGSGAFVVGLRYGEGTLYTKNAGDRKVYWQGPSIGFDFGGNGSRTFMLVYNLPDTDAIYQRFPGVEGSAYFVGGFGVTYLRAGDVVLAPIRSGVGLRLGANVGYLKFTRKPTWNPF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	160 (159)
Sequences:	2561 (1135)
Seq/√Len:	90.0
META:	0.906

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
97_P	101_A	4.190	1.00
91_M	131_L	3.541	1.00
50_F	82_F	3.429	1.00
113_A	142_L	3.277	1.00
30_A	121_V	3.185	1.00
39_G	61_L	3.045	1.00
124_L	151_F	2.808	1.00
58_E	70_K	2.797	1.00
100_D	153_R	2.745	1.00
104_Q	126_A	2.672	1.00
125_R	130_V	2.490	1.00
19_T	136_S	2.467	1.00
29_K	33_D	2.457	1.00
12_G	23_L	2.250	1.00
4_S	7_E	2.244	1.00
152_T	156_T	2.197	1.00
26_V	119_F	2.171	1.00
150_K	156_T	2.059	1.00
21_E	25_S	2.057	1.00
39_G	63_T	2.037	1.00
8_I	31_F	2.020	1.00
6_D	10_D	1.978	1.00
123_Y	132_A	1.952	1.00
28_E	36_R	1.939	1.00
140_L	144_A	1.906	1.00
106_F	129_V	1.864	1.00
131_L	151_F	1.793	1.00
25_S	28_E	1.759	1.00
155_P	158_N	1.664	1.00
51_V	82_F	1.655	1.00
51_V	78_I	1.655	1.00
63_T	66_A	1.640	1.00
69_R	103_Y	1.629	1.00
11_A	14_G	1.601	1.00
125_R	128_D	1.591	1.00
115_F	140_L	1.570	1.00
119_F	134_I	1.564	1.00
8_I	27_I	1.546	1.00
38_N	63_T	1.543	1.00
26_V	121_V	1.513	1.00
91_M	149_L	1.469	1.00
27_I	134_I	1.446	0.99
91_M	151_F	1.437	0.99
44_E	58_E	1.418	0.99
60_T	68_D	1.331	0.99
60_T	70_K	1.330	0.99
113_A	140_L	1.307	0.99
29_K	32_S	1.304	0.99
26_V	30_A	1.300	0.99
109_V	112_S	1.295	0.99
31_F	36_R	1.287	0.99
4_S	36_R	1.266	0.99
96_L	129_V	1.237	0.98
36_R	64_K	1.193	0.98
10_D	14_G	1.190	0.98
95_N	130_V	1.190	0.98
63_T	99_T	1.186	0.98
42_L	62_Y	1.177	0.98
20_S	136_S	1.155	0.97
18_K	22_G	1.149	0.97
74_Q	152_T	1.146	0.97
69_R	99_T	1.145	0.97
137_G	143_G	1.139	0.97
101_A	104_Q	1.133	0.97
85_N	117_G	1.120	0.97
98_D	101_A	1.102	0.96
152_T	155_P	1.102	0.96
71_V	102_I	1.063	0.96
104_Q	129_V	1.042	0.95
66_A	69_R	1.034	0.95
150_K	158_N	1.030	0.95
16_F	20_S	1.018	0.94
112_S	120_G	0.996	0.94
9_V	13_H	0.984	0.93
5_E	12_G	0.981	0.93
85_N	110_E	0.978	0.93
38_N	97_P	0.977	0.93
13_H	18_K	0.971	0.93
34_Q	130_V	0.970	0.93
21_E	34_Q	0.969	0.93
26_V	29_K	0.961	0.93
2_T	36_R	0.960	0.93
38_N	96_L	0.950	0.92
40_Y	62_Y	0.934	0.91
62_Y	68_D	0.930	0.91
15_F	42_L	0.923	0.91
109_V	125_R	0.917	0.91
96_L	101_A	0.909	0.90
71_V	103_Y	0.906	0.90
63_T	67_G	0.888	0.89
108_G	122_T	0.885	0.89
5_E	28_E	0.884	0.89
32_S	154_K	0.860	0.88
126_A	150_K	0.859	0.88
65_N	68_D	0.848	0.87
30_A	34_Q	0.843	0.87
18_K	23_L	0.829	0.86
12_G	27_I	0.826	0.86
25_S	39_G	0.822	0.85
13_H	22_G	0.812	0.85
58_E	155_P	0.808	0.84
61_L	64_K	0.802	0.84
42_L	60_T	0.784	0.82
106_F	126_A	0.783	0.82
16_F	22_G	0.777	0.82
115_F	142_L	0.766	0.81
86_G	138_V	0.756	0.80
31_F	34_Q	0.754	0.80
3_Y	62_Y	0.753	0.80
107_P	124_L	0.748	0.79
22_G	25_S	0.743	0.79
61_L	96_L	0.738	0.78
13_H	88_R	0.736	0.78
86_G	90_F	0.733	0.78
143_G	148_Y	0.730	0.78
13_H	21_E	0.730	0.78
19_T	22_G	0.728	0.78
104_Q	127_G	0.727	0.77
20_S	24_A	0.724	0.77
3_Y	6_D	0.724	0.77
73_W	76_P	0.723	0.77
132_A	137_G	0.722	0.77
58_E	74_Q	0.722	0.77
34_Q	123_Y	0.721	0.77
69_R	100_D	0.720	0.77
109_V	122_T	0.716	0.76
104_Q	110_E	0.705	0.75
20_S	25_S	0.704	0.75
20_S	23_L	0.704	0.75
5_E	9_V	0.700	0.75
101_A	129_V	0.699	0.75
61_L	71_V	0.692	0.74
38_N	58_E	0.692	0.74
137_G	141_R	0.691	0.74
133_P	137_G	0.690	0.74
11_A	42_L	0.686	0.73
10_D	13_H	0.680	0.73
65_N	69_R	0.677	0.72
74_Q	158_N	0.671	0.72
48_G	84_G	0.667	0.71
61_L	102_I	0.665	0.71
26_V	41_I	0.664	0.71
63_T	102_I	0.662	0.71
110_E	122_T	0.662	0.71
96_L	130_V	0.659	0.70
14_G	18_K	0.659	0.70
47_S	52_V	0.658	0.70
69_R	153_R	0.654	0.70
85_N	112_S	0.653	0.70
45_E	73_W	0.647	0.69
7_E	11_A	0.646	0.69
5_E	10_D	0.645	0.69
43_G	73_W	0.643	0.68
6_D	9_V	0.640	0.68
31_F	119_F	0.639	0.68
107_P	125_R	0.639	0.68
87_S	114_Y	0.636	0.68
55_R	78_I	0.636	0.68
149_L	160_F	0.634	0.67
128_D	154_K	0.625	0.66
122_T	151_F	0.621	0.66
74_Q	156_T	0.621	0.66
2_T	6_D	0.620	0.66
152_T	158_N	0.610	0.64
110_E	135_R	0.609	0.64
40_Y	46_G	0.606	0.64
6_D	89_T	0.606	0.64
41_I	71_V	0.605	0.64
11_A	26_V	0.603	0.63
13_H	19_T	0.602	0.63
65_N	99_T	0.602	0.63
71_V	96_L	0.600	0.63
38_N	66_A	0.598	0.63
55_R	117_G	0.592	0.62
108_G	146_V	0.591	0.62
43_G	92_L	0.589	0.62
102_I	151_F	0.589	0.62
18_K	21_E	0.588	0.62
80_F	144_A	0.588	0.62
10_D	18_K	0.585	0.61
74_Q	108_G	0.585	0.61
26_V	31_F	0.584	0.61
53_G	57_G	0.577	0.60
4_S	10_D	0.576	0.60
7_E	64_K	0.576	0.60
74_Q	150_K	0.574	0.60
63_T	113_A	0.573	0.60
136_S	139_G	0.572	0.59
42_L	58_E	0.570	0.59
90_F	123_Y	0.570	0.59
8_I	12_G	0.567	0.59
45_E	110_E	0.565	0.58
39_G	96_L	0.563	0.58
129_V	133_P	0.562	0.58
101_A	128_D	0.562	0.58
58_E	72_Y	0.562	0.58
12_G	90_F	0.557	0.57
157_W	160_F	0.554	0.57
6_D	13_H	0.550	0.56
6_D	11_A	0.548	0.56
35_G	76_P	0.545	0.56
78_I	82_F	0.545	0.56
23_L	119_F	0.545	0.56
146_V	154_K	0.543	0.56
8_I	14_G	0.542	0.55
73_W	92_L	0.539	0.55
4_S	14_G	0.538	0.55
85_N	124_L	0.536	0.55
113_A	117_G	0.535	0.54
17_G	28_E	0.535	0.54
31_F	87_S	0.533	0.54
12_G	150_K	0.532	0.54
9_V	14_G	0.532	0.54
84_G	140_L	0.531	0.54
153_R	157_W	0.530	0.54
47_S	84_G	0.529	0.54
135_R	141_R	0.529	0.54
56_Y	81_D	0.528	0.53
114_Y	120_G	0.525	0.53
46_G	74_Q	0.519	0.52
116_V	140_L	0.518	0.52
63_T	69_R	0.517	0.52
150_K	155_P	0.516	0.52
123_Y	126_A	0.516	0.52
41_I	74_Q	0.515	0.52
85_N	114_Y	0.511	0.51
154_K	158_N	0.511	0.51
80_F	84_G	0.508	0.51
62_Y	89_T	0.507	0.51
46_G	62_Y	0.505	0.50
137_G	148_Y	0.504	0.50
38_N	67_G	0.502	0.50
98_D	153_R	0.501	0.50
12_G	19_T	0.501	0.50
7_E	10_D	0.501	0.50
102_I	124_L	0.500	0.50
106_F	130_V	0.500	0.50
8_I	157_W	0.500	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2v7yA	1	0.525	8	0.957	Contact Map
4jneA	2	0.5	7.8	0.957	Contact Map
3d00A	2	0.6375	6	0.959	Contact Map
4m7xA	2	0.4562	5.8	0.959	Contact Map
1jcuA	1	0.3438	5.6	0.96	Contact Map
4opeA	2	0.8438	4.8	0.961	Contact Map
1k7jA	1	0.35	4.4	0.962	Contact Map
2i3sB	1	0.1187	4.3	0.962	Contact Map
2itmA	2	0.5062	4.1	0.962	Contact Map
2c1xA	1	0.35	3.8	0.963	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.