DUF1097 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1097 - Protein of unknown function (DUF1097)

PFAM:	PF06496	Sequences: ALSIGVLAGVWTWLALGLGNLLVWAAFIAWACYFAAGGGLKGLKKTIAGNLFGVVWAWLALLLAGALGGGLGLLAAVWAVGVVVFVMVLLAKIPLLSFIPAAFYGFAATFAYLLLTGGATLGNPLLVVIVSLVIGAVFGYLSEKLAQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	147 (145)
Sequences:	2472 (1684)
Seq/√Len:	139.8
META:	0.793

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_A	111_A	3.542	1.00
39_G	42_G	3.008	1.00
9_G	81_G	2.873	1.00
52_F	90_L	2.869	1.00
32_C	46_T	2.754	1.00
83_V	106_F	2.651	1.00
74_L	77_V	2.611	1.00
85_F	89_L	2.600	1.00
63_L	79_A	2.378	1.00
57_A	109_T	2.327	1.00
28_I	108_A	2.178	1.00
51_L	129_I	2.155	1.00
28_I	104_Y	2.102	1.00
24_W	111_A	2.100	1.00
58_W	125_L	2.098	1.00
50_N	132_L	2.041	1.00
137_V	141_L	2.021	1.00
32_C	50_N	1.977	1.00
35_A	104_Y	1.959	1.00
73_L	76_A	1.931	1.00
74_L	78_W	1.909	1.00
36_A	98_F	1.900	1.00
33_Y	143_E	1.780	1.00
43_L	136_A	1.766	1.00
72_G	76_A	1.696	1.00
55_V	59_L	1.695	1.00
35_A	98_F	1.692	1.00
41_K	45_K	1.665	1.00
6_V	145_L	1.620	1.00
61_L	113_L	1.597	1.00
30_W	142_S	1.572	1.00
11_W	26_A	1.528	1.00
47_I	136_A	1.526	1.00
141_L	145_L	1.520	1.00
41_K	44_K	1.506	1.00
46_T	136_A	1.484	1.00
31_A	107_A	1.476	1.00
134_I	138_F	1.438	1.00
15_A	26_A	1.432	1.00
98_F	101_A	1.409	1.00
11_W	15_A	1.393	1.00
103_F	110_F	1.391	1.00
32_C	104_Y	1.390	1.00
27_F	103_F	1.370	1.00
71_L	76_A	1.361	1.00
52_F	102_A	1.335	1.00
80_V	110_F	1.320	1.00
39_G	143_E	1.311	1.00
43_L	137_V	1.296	1.00
47_I	133_V	1.296	1.00
54_V	109_T	1.292	1.00
89_L	92_K	1.268	1.00
87_M	102_A	1.250	1.00
45_K	98_F	1.248	1.00
61_L	110_F	1.198	1.00
71_L	78_W	1.169	0.99
140_Y	144_K	1.152	0.99
62_L	66_A	1.149	0.99
54_V	132_L	1.136	0.99
49_G	101_A	1.121	0.99
71_L	77_V	1.106	0.99
12_T	15_A	1.095	0.99
84_V	88_V	1.082	0.99
63_L	66_A	1.069	0.99
27_F	110_F	1.059	0.99
28_I	107_A	1.036	0.99
60_A	83_V	1.021	0.99
3_S	145_L	1.018	0.99
70_G	76_A	0.977	0.98
33_Y	38_G	0.977	0.98
7_L	34_F	0.973	0.98
125_L	132_L	0.966	0.98
71_L	74_L	0.964	0.98
132_L	138_F	0.958	0.98
57_A	106_F	0.956	0.98
13_W	17_G	0.951	0.98
104_Y	108_A	0.945	0.98
34_F	142_S	0.938	0.98
73_L	78_W	0.935	0.98
29_A	46_T	0.927	0.97
121_L	128_V	0.923	0.97
52_F	56_W	0.917	0.97
14_L	17_G	0.915	0.97
14_L	138_F	0.911	0.97
116_T	120_T	0.907	0.97
68_G	78_W	0.903	0.97
67_L	72_G	0.899	0.97
72_G	77_V	0.895	0.97
86_V	90_L	0.882	0.97
56_W	90_L	0.880	0.96
32_C	136_A	0.872	0.96
81_G	88_V	0.872	0.96
75_A	78_W	0.860	0.96
40_L	44_K	0.860	0.96
83_V	87_M	0.846	0.96
12_T	80_V	0.832	0.95
33_Y	139_G	0.830	0.95
73_L	77_V	0.828	0.95
122_G	126_L	0.828	0.95
90_L	99_I	0.825	0.95
130_V	133_V	0.813	0.95
115_L	118_G	0.809	0.94
87_M	91_A	0.806	0.94
29_A	132_L	0.804	0.94
12_T	19_G	0.804	0.94
70_G	75_A	0.795	0.94
54_V	128_V	0.791	0.94
87_M	106_F	0.787	0.94
79_A	83_V	0.787	0.94
69_G	72_G	0.784	0.93
5_G	85_F	0.781	0.93
8_A	80_V	0.772	0.93
51_L	133_V	0.768	0.93
34_F	103_F	0.767	0.93
81_G	84_V	0.767	0.93
90_L	96_L	0.762	0.92
117_G	120_T	0.755	0.92
49_G	98_F	0.755	0.92
112_Y	115_L	0.755	0.92
88_V	91_A	0.753	0.92
56_W	96_L	0.747	0.92
36_A	42_G	0.741	0.91
91_A	99_I	0.740	0.91
42_G	46_T	0.735	0.91
60_A	106_F	0.726	0.90
53_G	57_A	0.725	0.90
57_A	128_V	0.725	0.90
8_A	12_T	0.721	0.90
67_L	70_G	0.721	0.90
54_V	129_I	0.708	0.89
51_L	55_V	0.707	0.89
59_L	83_V	0.700	0.89
22_L	115_L	0.698	0.89
62_L	121_L	0.694	0.88
56_W	83_V	0.693	0.88
86_V	89_L	0.691	0.88
27_F	34_F	0.691	0.88
80_V	84_V	0.690	0.88
22_L	127_V	0.688	0.88
34_F	143_E	0.687	0.88
127_V	131_S	0.686	0.88
116_T	119_A	0.683	0.88
57_A	87_M	0.680	0.87
7_L	142_S	0.679	0.87
105_G	133_V	0.675	0.87
64_A	67_L	0.672	0.87
33_Y	40_L	0.663	0.86
81_G	85_F	0.659	0.86
45_K	48_A	0.654	0.85
33_Y	39_G	0.652	0.85
3_S	7_L	0.647	0.85
11_W	16_L	0.647	0.85
31_A	146_A	0.640	0.84
64_A	75_A	0.634	0.83
124_P	135_G	0.625	0.83
4_I	7_L	0.624	0.82
123_N	129_I	0.622	0.82
28_I	111_A	0.615	0.82
5_G	11_W	0.614	0.81
128_V	132_L	0.613	0.81
44_K	48_A	0.607	0.81
84_V	103_F	0.606	0.81
114_L	117_G	0.605	0.81
29_A	32_C	0.597	0.80
40_L	43_L	0.596	0.80
50_N	136_A	0.595	0.79
14_L	18_L	0.588	0.79
22_L	131_S	0.584	0.78
48_A	52_F	0.577	0.77
9_G	12_T	0.576	0.77
35_A	101_A	0.575	0.77
45_K	49_G	0.575	0.77
67_L	71_L	0.575	0.77
133_V	137_V	0.570	0.76
100_P	107_A	0.570	0.76
128_V	131_S	0.569	0.76
48_A	95_L	0.567	0.76
24_W	105_G	0.567	0.76
40_L	144_K	0.566	0.76
125_L	129_I	0.564	0.76
56_W	86_V	0.560	0.75
15_A	23_V	0.560	0.75
42_G	143_E	0.552	0.74
49_G	102_A	0.550	0.74
60_A	110_F	0.549	0.74
41_K	92_K	0.547	0.74
21_L	131_S	0.547	0.74
134_I	141_L	0.547	0.74
45_K	93_I	0.546	0.73
48_A	140_Y	0.544	0.73
85_F	88_V	0.544	0.73
124_P	131_S	0.544	0.73
15_A	18_L	0.544	0.73
118_G	123_N	0.544	0.73
125_L	128_V	0.543	0.73
90_L	102_A	0.543	0.73
121_L	124_P	0.542	0.73
64_A	79_A	0.539	0.72
27_F	30_W	0.537	0.72
21_L	25_A	0.536	0.72
84_V	87_M	0.534	0.72
38_G	143_E	0.533	0.72
36_A	104_Y	0.531	0.71
40_L	140_Y	0.529	0.71
8_A	11_W	0.525	0.70
65_G	72_G	0.524	0.70
4_I	8_A	0.523	0.70
138_F	142_S	0.523	0.70
8_A	107_A	0.523	0.70
45_K	97_S	0.522	0.70
70_G	73_L	0.522	0.70
29_A	142_S	0.521	0.70
12_T	16_L	0.519	0.70
47_I	51_L	0.513	0.69
5_G	13_W	0.508	0.68
84_V	91_A	0.505	0.68
11_W	49_G	0.503	0.67
8_A	15_A	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4b19A	1	0.1769	2.1	0.93	Contact Map
2kv5A	1	0.1837	1.9	0.932	Contact Map
2ksfA	1	0.6735	1.3	0.938	Contact Map
4ogqG	1	0.1361	1.2	0.94	Contact Map
1q90G	1	0.1361	1.2	0.94	Contact Map
4f35D	2	0.6667	1.1	0.94	Contact Map
1q90M	1	0.2109	0.9	0.943	Contact Map
1rzhL	1	0.3333	0.9	0.944	Contact Map
3iyzA	3	0.9796	0.8	0.945	Contact Map
3oufA	4	0.5374	0.8	0.947	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.