GWT1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GWT1 - GWT1

PFAM:	PF06423	Sequences: ANREGIFSLLGYLAIYLAGVQTGLYLLPRSKKRSSVKEWIKLLIKLLLWSLVLWLLLYLSTSYVEPVSRRLANLPYVLWVVAFNLTFLLLFLLIDLLLFKEEEKERSKLATSCLLEAINRNGLAFFLLANLLTGLVN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	137 (136)
Sequences:	759 (586)
Seq/√Len:	50.3
META:	0.24

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
12_Y	72_A	3.566	1.00
119_N	122_G	3.020	1.00
54_W	86_T	2.856	1.00
134_G	137_N	2.549	1.00
72_A	77_V	2.494	1.00
54_W	82_A	2.436	1.00
19_G	81_V	2.369	1.00
8_S	72_A	2.260	1.00
14_A	18_A	2.221	1.00
87_F	91_F	2.215	1.00
130_N	134_G	2.018	1.00
76_Y	80_V	1.937	0.99
56_L	78_L	1.928	0.99
13_L	91_F	1.879	0.99
133_T	137_N	1.825	0.99
3_R	9_L	1.822	0.99
130_N	133_T	1.798	0.99
52_V	56_L	1.756	0.99
83_F	87_F	1.751	0.99
130_N	137_N	1.728	0.99
3_R	7_F	1.710	0.99
39_W	42_L	1.687	0.98
52_V	55_L	1.685	0.98
2_N	5_G	1.659	0.98
131_L	135_L	1.594	0.98
4_E	8_S	1.587	0.98
133_T	136_V	1.580	0.98
92_L	96_L	1.555	0.97
35_S	55_L	1.538	0.97
12_Y	70_R	1.529	0.97
126_F	130_N	1.511	0.97
20_V	23_G	1.508	0.97
101_E	105_E	1.496	0.97
132_L	135_L	1.448	0.96
9_L	122_G	1.422	0.95
57_L	71_L	1.382	0.95
19_G	23_G	1.336	0.94
117_A	121_N	1.326	0.93
91_F	95_D	1.309	0.93
129_A	133_T	1.297	0.93
8_S	127_L	1.277	0.92
69_R	130_N	1.274	0.92
53_L	81_V	1.268	0.92
112_S	119_N	1.266	0.92
12_Y	68_S	1.259	0.91
118_I	125_F	1.243	0.91
38_E	46_L	1.238	0.91
8_S	133_T	1.213	0.90
8_S	12_Y	1.202	0.89
26_L	76_Y	1.201	0.89
53_L	85_L	1.187	0.89
26_L	81_V	1.185	0.89
23_G	117_A	1.158	0.88
41_K	62_S	1.157	0.87
69_R	73_N	1.153	0.87
67_V	117_A	1.152	0.87
47_L	89_L	1.137	0.87
44_I	49_W	1.133	0.86
60_S	78_L	1.117	0.86
73_N	76_Y	1.109	0.85
1_A	131_L	1.106	0.85
16_Y	20_V	1.094	0.84
7_F	10_L	1.086	0.84
125_F	136_V	1.086	0.84
19_G	93_L	1.084	0.84
60_S	118_I	1.077	0.83
101_E	104_K	1.075	0.83
36_V	39_W	1.072	0.83
68_S	71_L	1.054	0.82
35_S	38_E	1.054	0.82
87_F	118_I	1.051	0.82
22_T	85_L	1.030	0.81
84_N	122_G	1.023	0.80
46_L	52_V	1.014	0.79
110_A	136_V	1.009	0.79
82_A	86_T	1.005	0.79
8_S	76_Y	0.998	0.78
90_L	118_I	0.993	0.78
100_K	107_S	0.988	0.78
100_K	109_L	0.982	0.77
3_R	87_F	0.950	0.75
3_R	8_S	0.943	0.74
72_A	76_Y	0.942	0.74
23_G	79_W	0.927	0.73
100_K	103_E	0.913	0.72
89_L	98_L	0.894	0.70
11_G	133_T	0.894	0.70
51_L	56_L	0.893	0.70
121_N	124_A	0.892	0.70
117_A	123_L	0.890	0.70
76_Y	91_F	0.889	0.70
120_R	135_L	0.887	0.70
100_K	104_K	0.884	0.69
1_A	90_L	0.877	0.69
94_I	119_N	0.877	0.69
80_V	125_F	0.860	0.67
23_G	27_L	0.858	0.67
19_G	88_L	0.858	0.67
8_S	11_G	0.853	0.67
31_K	43_L	0.831	0.65
47_L	62_S	0.829	0.64
38_E	60_S	0.806	0.62
74_L	78_L	0.804	0.62
11_G	119_N	0.792	0.61
84_N	91_F	0.783	0.60
23_G	95_D	0.780	0.60
60_S	63_Y	0.772	0.59
15_I	27_L	0.766	0.58
112_S	122_G	0.761	0.58
16_Y	80_V	0.760	0.58
6_I	27_L	0.758	0.57
45_K	52_V	0.755	0.57
101_E	107_S	0.755	0.57
41_K	88_L	0.754	0.57
12_Y	122_G	0.750	0.57
30_S	51_L	0.749	0.57
87_F	90_L	0.742	0.56
123_L	129_A	0.742	0.56
5_G	8_S	0.742	0.56
7_F	17_L	0.731	0.55
50_S	89_L	0.729	0.55
30_S	46_L	0.729	0.55
104_K	108_K	0.722	0.54
100_K	105_E	0.720	0.54
127_L	130_N	0.718	0.53
50_S	135_L	0.716	0.53
31_K	51_L	0.715	0.53
19_G	83_F	0.713	0.53
41_K	44_I	0.712	0.53
33_R	36_V	0.712	0.53
15_I	80_V	0.709	0.53
5_G	126_F	0.708	0.52
22_T	93_L	0.702	0.52
7_F	129_A	0.697	0.51
32_K	40_I	0.697	0.51
25_Y	33_R	0.694	0.51
1_A	118_I	0.691	0.51
40_I	51_L	0.690	0.51
6_I	108_K	0.690	0.51
102_E	108_K	0.689	0.50
20_V	85_L	0.686	0.50
15_I	72_A	0.680	0.50
65_E	122_G	0.679	0.49
97_L	103_E	0.679	0.49
9_L	15_I	0.676	0.49
103_E	107_S	0.675	0.49
57_L	61_T	0.669	0.48
83_F	128_L	0.669	0.48
19_G	112_S	0.663	0.48
12_Y	119_N	0.662	0.48
23_G	26_L	0.658	0.47
25_Y	95_D	0.658	0.47
38_E	57_L	0.654	0.47
41_K	51_L	0.654	0.47
21_Q	95_D	0.644	0.46
6_I	24_L	0.626	0.44
51_L	82_A	0.624	0.44
58_Y	63_Y	0.619	0.43
42_L	45_K	0.619	0.43
63_Y	66_P	0.617	0.43
102_E	105_E	0.617	0.43
60_S	98_L	0.615	0.43
85_L	89_L	0.613	0.43
38_E	92_L	0.600	0.41
67_V	78_L	0.600	0.41
101_E	108_K	0.600	0.41
3_R	42_L	0.597	0.41
37_K	40_I	0.593	0.41
46_L	115_L	0.592	0.41
52_V	106_R	0.589	0.40
32_K	88_L	0.585	0.40
78_L	111_T	0.585	0.40
72_A	85_L	0.582	0.40
53_L	120_R	0.577	0.39
79_W	87_F	0.575	0.39
64_V	80_V	0.572	0.39
111_T	114_L	0.569	0.38
16_Y	71_L	0.564	0.38
73_N	130_N	0.562	0.38
68_S	133_T	0.556	0.37
26_L	61_T	0.553	0.37
69_R	127_L	0.540	0.36
56_L	118_I	0.535	0.35
48_L	53_L	0.535	0.35
1_A	77_V	0.532	0.35
128_L	131_L	0.531	0.35
123_L	137_N	0.530	0.35
12_Y	84_N	0.523	0.34
21_Q	25_Y	0.522	0.34
34_S	102_E	0.520	0.34
123_L	133_T	0.518	0.34
2_N	130_N	0.515	0.33
25_Y	125_F	0.514	0.33
27_L	38_E	0.513	0.33
113_C	128_L	0.513	0.33
110_A	116_E	0.512	0.33
34_S	106_R	0.512	0.33
105_E	109_L	0.512	0.33
77_V	119_N	0.510	0.33
75_P	122_G	0.506	0.32
44_I	48_L	0.504	0.32
77_V	98_L	0.503	0.32
40_I	45_K	0.501	0.32
116_E	124_A	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4x5mA	2	0.6861	1.9	0.95	Contact Map
2krtA	1	0.3212	1.8	0.95	Contact Map
3j8eG	3	0.9197	1.7	0.951	Contact Map
2gsmB	1	0.3212	1.5	0.953	Contact Map
2remA	1	0.3285	1.3	0.954	Contact Map
3pcvA	3	0.4964	1.3	0.954	Contact Map
4lz6A	1	0.9854	1.2	0.955	Contact Map
4aaiA	2	0.1825	1.2	0.955	Contact Map
3k2tA	1	0.2555	1.1	0.956	Contact Map
3j9pD	4	0.927	1	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.