DUF1071 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1071 - Protein of unknown function (DUF1071)

PFAM:	PF06378	Sequences: KVFETLSKIDVNDHTEKKGGLTYLSWAWAWAELKKHYPDATYEVYEFDGTGLPYFTDGGTAMVKVTVTIEGITHTMWLPVMDNRNKAIENPTSFDVNTAIMRCLVKAIAMHGLGLYIYAGEDLPEEEEPKKEPKKAKKIKKKKKATPE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	148 (133)
Sequences:	2933 (2052)
Seq/√Len:	177.9
META:	0.967

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_T	22_T	4.384	1.00
92_T	95_D	3.246	1.00
94_F	98_T	3.163	1.00
32_E	35_K	3.073	1.00
33_L	69_I	2.695	1.00
66_T	73_T	2.679	1.00
34_K	74_H	2.383	1.00
76_M	101_M	2.235	1.00
33_L	108_I	2.169	1.00
82_D	86_K	2.070	1.00
65_V	107_A	2.056	1.00
2_V	5_T	2.028	1.00
14_H	28_W	2.028	1.00
43_E	66_T	1.930	1.00
2_V	37_Y	1.900	1.00
68_T	73_T	1.846	1.00
30_W	40_A	1.711	1.00
61_A	91_P	1.688	1.00
28_W	119_A	1.687	1.00
7_S	31_A	1.675	1.00
32_E	36_H	1.608	1.00
17_K	22_T	1.552	1.00
3_F	31_A	1.490	1.00
4_E	8_K	1.484	1.00
5_T	36_H	1.474	1.00
5_T	37_Y	1.471	1.00
61_A	80_V	1.469	1.00
42_Y	104_L	1.464	1.00
94_F	97_N	1.463	1.00
31_A	115_L	1.460	1.00
66_T	75_T	1.460	1.00
33_L	40_A	1.455	1.00
7_S	35_K	1.441	1.00
46_E	64_K	1.437	1.00
67_V	108_I	1.430	1.00
31_A	35_K	1.424	1.00
42_Y	110_M	1.413	1.00
107_A	111_H	1.400	1.00
81_M	98_T	1.388	1.00
78_L	103_C	1.365	1.00
2_V	72_I	1.330	1.00
37_Y	70_E	1.315	1.00
79_P	94_F	1.306	1.00
76_M	110_M	1.297	1.00
65_V	103_C	1.292	1.00
39_D	70_E	1.284	1.00
87_A	93_S	1.284	1.00
15_T	117_I	1.276	1.00
20_G	84_R	1.273	1.00
12_N	15_T	1.268	1.00
12_N	116_Y	1.262	1.00
62_M	100_I	1.251	1.00
9_I	36_H	1.222	1.00
10_D	13_D	1.211	1.00
39_D	71_G	1.179	1.00
81_M	94_F	1.156	1.00
17_K	20_G	1.155	1.00
30_W	42_Y	1.154	1.00
44_V	100_I	1.138	1.00
29_A	108_I	1.128	1.00
65_V	100_I	1.127	1.00
3_F	115_L	1.107	1.00
64_K	75_T	1.064	1.00
47_F	50_T	1.045	1.00
63_V	99_A	1.022	0.99
25_S	122_D	1.005	0.99
76_M	107_A	1.001	0.99
44_V	65_V	0.993	0.99
95_D	98_T	0.988	0.99
41_T	68_T	0.986	0.99
3_F	7_S	0.981	0.99
24_L	29_A	0.979	0.99
5_T	8_K	0.977	0.99
127_E	130_K	0.970	0.99
56_T	61_A	0.962	0.99
27_A	119_A	0.953	0.99
79_P	97_N	0.949	0.99
45_Y	66_T	0.930	0.99
24_L	117_I	0.929	0.99
86_K	95_D	0.917	0.99
21_L	81_M	0.905	0.99
2_V	69_I	0.903	0.99
19_G	83_N	0.896	0.99
14_H	32_E	0.888	0.98
78_L	81_M	0.888	0.98
82_D	95_D	0.867	0.98
131_K	134_K	0.865	0.98
88_I	95_D	0.861	0.98
2_V	70_E	0.834	0.98
53_P	57_D	0.833	0.98
16_E	25_S	0.833	0.98
129_P	132_E	0.832	0.98
16_E	120_G	0.830	0.98
34_K	40_A	0.825	0.98
67_V	107_A	0.822	0.97
43_E	68_T	0.822	0.97
116_Y	124_P	0.818	0.97
64_K	77_W	0.807	0.97
44_V	101_M	0.805	0.97
48_D	51_G	0.797	0.97
56_T	62_M	0.793	0.97
4_E	35_K	0.789	0.97
46_E	75_T	0.788	0.97
30_W	104_L	0.786	0.97
86_K	89_E	0.786	0.97
68_T	71_G	0.785	0.97
128_E	131_K	0.776	0.96
81_M	87_A	0.766	0.96
60_T	93_S	0.751	0.96
11_V	32_E	0.749	0.96
48_D	55_F	0.747	0.96
73_T	111_H	0.737	0.95
30_W	34_K	0.733	0.95
74_H	111_H	0.729	0.95
87_A	92_T	0.724	0.95
76_M	104_L	0.723	0.95
86_K	94_F	0.714	0.94
101_M	110_M	0.712	0.94
77_W	101_M	0.709	0.94
47_F	64_K	0.705	0.94
74_H	110_M	0.704	0.94
25_S	28_W	0.703	0.94
78_L	99_A	0.688	0.93
45_Y	48_D	0.681	0.93
130_K	133_P	0.680	0.93
83_N	94_F	0.679	0.93
108_I	111_H	0.676	0.93
28_W	32_E	0.674	0.92
47_F	51_G	0.672	0.92
52_L	62_M	0.670	0.92
48_D	52_L	0.669	0.92
41_T	74_H	0.664	0.92
129_P	134_K	0.662	0.92
21_L	118_Y	0.662	0.92
35_K	125_E	0.655	0.91
86_K	90_N	0.654	0.91
42_Y	76_M	0.653	0.91
51_G	55_F	0.653	0.91
128_E	133_P	0.652	0.91
128_E	132_E	0.650	0.91
30_W	110_M	0.644	0.91
46_E	51_G	0.642	0.91
67_V	111_H	0.638	0.90
16_E	28_W	0.637	0.90
46_E	50_T	0.637	0.90
45_Y	50_T	0.636	0.90
82_D	85_N	0.634	0.90
34_K	72_I	0.631	0.90
28_W	31_A	0.631	0.90
105_V	113_L	0.622	0.89
11_V	28_W	0.615	0.89
83_N	88_I	0.613	0.88
80_V	96_V	0.613	0.88
81_M	85_N	0.609	0.88
54_Y	61_A	0.605	0.88
24_L	28_W	0.605	0.88
13_D	116_Y	0.604	0.88
81_M	92_T	0.602	0.88
79_P	98_T	0.599	0.87
77_W	100_I	0.595	0.87
40_A	108_I	0.592	0.87
56_T	59_G	0.591	0.87
21_L	78_L	0.591	0.87
130_K	134_K	0.588	0.86
33_L	37_Y	0.586	0.86
98_T	125_E	0.579	0.85
11_V	24_L	0.575	0.85
83_N	86_K	0.575	0.85
58_G	92_T	0.573	0.85
91_P	95_D	0.571	0.85
87_A	91_P	0.559	0.83
18_K	85_N	0.559	0.83
30_W	74_H	0.557	0.83
44_V	77_W	0.557	0.83
47_F	52_L	0.555	0.83
57_D	62_M	0.553	0.83
28_W	116_Y	0.550	0.82
129_P	133_P	0.549	0.82
28_W	115_L	0.548	0.82
45_Y	75_T	0.548	0.82
105_V	109_A	0.547	0.82
54_Y	57_D	0.544	0.82
12_N	22_T	0.540	0.81
101_M	107_A	0.535	0.81
61_A	96_V	0.531	0.80
76_M	103_C	0.527	0.80
53_P	56_T	0.525	0.79
109_A	118_Y	0.523	0.79
37_Y	40_A	0.522	0.79
126_E	129_P	0.522	0.79
27_A	122_D	0.522	0.79
96_V	100_I	0.518	0.79
57_D	60_T	0.517	0.78
37_Y	69_I	0.515	0.78
127_E	132_E	0.513	0.78
83_N	95_D	0.513	0.78
62_M	96_V	0.511	0.78
25_S	123_L	0.506	0.77
2_V	7_S	0.506	0.77
40_A	69_I	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1h2iA	5	0.9527	70.6	0.915	Contact Map
4cvoA	2	0.277	22.9	0.938	Contact Map
1s3rA	3	0	6.6	0.951	Contact Map
2xb0X	1	0.3784	6.3	0.952	Contact Map
2ly1A	1	0.3378	4.1	0.956	Contact Map
1yvuA	1	0.4932	3.7	0.957	Contact Map
2lhuA	1	0.2297	3.6	0.957	Contact Map
3f42A	4	0.5878	3.6	0.957	Contact Map
4b4cA	2	0.3378	3.5	0.957	Contact Map
1hulA	2	0.3108	3.2	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.