ComK - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ComK - ComK protein

PFAM:	PF06338	Sequences: KENYEINPETMAIIPIYDEDGKYYTKVIEEDGEYIVKKSPLKIIDESCKYFGSSYEGRKEGTKKLLGITHKVPIIIEESNNIIFFPTKSPRNPDCIWISLNHIKKYEKIDKNKTIITFKNGKSIELDISYGSFENQILRAARLRYKLRKRKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	152 (147)
Sequences:	1116 (956)
Seq/√Len:	78.8
META:	0.515

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_I	25_T	5.388	1.00
114_T	133_F	3.956	1.00
84_F	99_S	3.205	1.00
71_K	136_Q	2.921	1.00
45_D	49_K	2.374	1.00
54_S	60_E	2.361	1.00
57_G	61_G	2.357	1.00
106_Y	133_F	2.306	1.00
83_I	140_A	2.296	1.00
116_I	133_F	2.285	1.00
38_K	46_E	2.279	1.00
100_L	140_A	2.210	1.00
115_I	123_S	2.168	1.00
56_E	60_E	2.110	1.00
103_I	137_I	2.004	1.00
53_S	58_R	1.981	1.00
107_E	115_I	1.805	1.00
12_A	124_I	1.753	1.00
128_I	133_F	1.729	1.00
113_K	127_D	1.703	1.00
11_M	102_H	1.687	1.00
87_T	95_C	1.678	1.00
53_S	57_G	1.670	1.00
38_K	42_K	1.650	1.00
107_E	117_T	1.632	1.00
104_K	121_G	1.612	1.00
113_K	125_E	1.555	0.99
26_K	33_E	1.544	0.99
55_Y	59_K	1.533	0.99
115_I	125_E	1.490	0.99
27_V	36_V	1.486	0.99
62_T	66_L	1.477	0.99
29_E	32_G	1.477	0.99
88_K	94_D	1.440	0.99
117_T	123_S	1.437	0.99
102_H	119_K	1.382	0.99
68_I	72_V	1.370	0.99
109_I	115_I	1.359	0.99
62_T	72_V	1.350	0.98
43_I	47_S	1.346	0.98
48_C	58_R	1.331	0.98
42_K	45_D	1.322	0.98
99_S	102_H	1.320	0.98
41_L	55_Y	1.313	0.98
30_E	102_H	1.292	0.98
16_I	26_K	1.282	0.98
106_Y	130_Y	1.265	0.98
59_K	74_I	1.234	0.97
39_S	42_K	1.215	0.97
49_K	60_E	1.182	0.96
144_R	148_R	1.179	0.96
11_M	118_F	1.175	0.96
78_E	83_I	1.150	0.96
75_I	143_L	1.149	0.96
136_Q	139_R	1.135	0.96
47_S	50_Y	1.134	0.96
44_I	76_I	1.126	0.95
98_I	116_I	1.123	0.95
33_E	122_K	1.123	0.95
10_T	29_E	1.118	0.95
104_K	119_K	1.116	0.95
128_I	132_S	1.108	0.95
62_T	143_L	1.105	0.95
90_P	95_C	1.105	0.95
54_S	61_G	1.076	0.94
15_P	96_I	1.060	0.94
55_Y	90_P	1.049	0.93
85_F	140_A	1.048	0.93
145_Y	148_R	1.047	0.93
8_P	80_N	1.046	0.93
106_Y	114_T	1.044	0.93
54_S	57_G	1.042	0.93
71_K	132_S	1.028	0.93
50_Y	150_R	1.018	0.92
18_D	22_K	1.014	0.92
135_N	139_R	1.012	0.92
45_D	56_E	1.006	0.92
22_K	37_K	0.999	0.91
44_I	55_Y	0.974	0.90
13_I	40_P	0.973	0.90
56_E	59_K	0.973	0.90
105_K	117_T	0.968	0.90
76_I	84_F	0.960	0.90
14_I	28_I	0.943	0.89
40_P	116_I	0.939	0.89
25_T	40_P	0.927	0.88
36_V	43_I	0.925	0.88
83_I	100_L	0.916	0.87
12_A	28_I	0.914	0.87
11_M	120_N	0.909	0.87
141_A	145_Y	0.903	0.87
60_E	63_K	0.893	0.86
62_T	68_I	0.889	0.86
59_K	63_K	0.880	0.85
129_S	136_Q	0.879	0.85
86_P	95_C	0.871	0.85
9_E	30_E	0.867	0.84
89_S	136_Q	0.859	0.84
57_G	95_C	0.857	0.84
98_I	126_L	0.857	0.84
4_Y	7_N	0.855	0.84
106_Y	137_I	0.852	0.83
48_C	71_K	0.850	0.83
100_L	144_R	0.841	0.83
100_L	141_A	0.840	0.82
55_Y	134_E	0.836	0.82
68_I	139_R	0.818	0.81
47_S	51_F	0.818	0.81
38_K	43_I	0.804	0.80
31_D	120_N	0.803	0.80
146_K	150_R	0.802	0.79
143_L	146_K	0.800	0.79
48_C	97_W	0.796	0.79
67_G	72_V	0.786	0.78
103_I	133_F	0.785	0.78
103_I	116_I	0.779	0.77
142_R	146_K	0.779	0.77
7_N	29_E	0.777	0.77
12_A	98_I	0.759	0.76
108_K	130_Y	0.758	0.76
52_G	66_L	0.750	0.75
77_E	80_N	0.741	0.74
138_L	142_R	0.739	0.74
16_I	35_I	0.737	0.73
44_I	84_F	0.735	0.73
130_Y	134_E	0.735	0.73
24_Y	37_K	0.734	0.73
4_Y	29_E	0.733	0.73
61_G	139_R	0.731	0.73
11_M	30_E	0.729	0.73
109_I	125_E	0.728	0.73
98_I	103_I	0.728	0.73
118_F	124_I	0.727	0.72
114_T	125_E	0.726	0.72
5_E	47_S	0.723	0.72
6_I	147_L	0.720	0.72
134_E	138_L	0.716	0.71
14_I	26_K	0.716	0.71
29_E	47_S	0.715	0.71
58_R	76_I	0.709	0.71
62_T	75_I	0.703	0.70
5_E	51_F	0.699	0.69
47_S	143_L	0.691	0.69
84_F	143_L	0.685	0.68
88_K	92_N	0.682	0.68
49_K	64_K	0.677	0.67
48_C	136_Q	0.675	0.67
86_P	136_Q	0.661	0.65
107_E	132_S	0.657	0.65
95_C	136_Q	0.655	0.64
7_N	116_I	0.655	0.64
24_Y	27_V	0.654	0.64
70_H	134_E	0.653	0.64
13_I	93_P	0.653	0.64
95_C	139_R	0.641	0.63
52_G	85_F	0.640	0.63
66_L	143_L	0.636	0.62
144_R	149_K	0.631	0.62
62_T	83_I	0.629	0.61
5_E	79_S	0.624	0.61
52_G	75_I	0.623	0.61
51_F	77_E	0.620	0.60
118_F	122_K	0.615	0.60
59_K	72_V	0.613	0.59
35_I	122_K	0.611	0.59
106_Y	134_E	0.606	0.58
70_H	95_C	0.606	0.58
109_I	113_K	0.605	0.58
32_G	46_E	0.604	0.58
98_I	118_F	0.603	0.58
138_L	145_Y	0.601	0.58
32_G	92_N	0.599	0.58
16_I	103_I	0.594	0.57
49_K	61_G	0.593	0.57
43_I	146_K	0.589	0.56
86_P	89_S	0.586	0.56
5_E	50_Y	0.586	0.56
92_N	113_K	0.583	0.56
66_L	146_K	0.582	0.55
13_I	44_I	0.579	0.55
123_S	126_L	0.575	0.55
68_I	135_N	0.570	0.54
132_S	135_N	0.568	0.54
6_I	10_T	0.567	0.54
8_P	39_S	0.567	0.54
61_G	120_N	0.567	0.54
81_N	101_N	0.565	0.53
10_T	47_S	0.565	0.53
87_T	136_Q	0.561	0.53
145_Y	149_K	0.558	0.52
30_E	55_Y	0.557	0.52
71_K	89_S	0.557	0.52
48_C	87_T	0.557	0.52
28_I	108_K	0.555	0.52
74_I	84_F	0.552	0.52
75_I	78_E	0.549	0.51
73_P	143_L	0.549	0.51
15_P	41_L	0.548	0.51
41_L	131_G	0.544	0.51
86_P	97_W	0.542	0.50
9_E	31_D	0.540	0.50
130_Y	137_I	0.536	0.50
4_Y	52_G	0.535	0.49
63_K	69_T	0.533	0.49
127_D	130_Y	0.533	0.49
85_F	97_W	0.533	0.49
50_Y	61_G	0.532	0.49
27_V	67_G	0.526	0.48
85_F	98_I	0.525	0.48
58_R	118_F	0.522	0.48
99_S	139_R	0.516	0.47
41_L	45_D	0.515	0.47
77_E	132_S	0.511	0.46
53_S	147_L	0.510	0.46
129_S	132_S	0.506	0.46
135_N	138_L	0.505	0.46
31_D	109_I	0.504	0.45
52_G	97_W	0.502	0.45
55_Y	124_I	0.500	0.45
27_V	128_I	0.500	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3d6wA	3	0.6579	24.4	0.918	Contact Map
3er9B	1	0.5987	8.4	0.933	Contact Map
1k8kD	1	0.8816	5.3	0.939	Contact Map
4atoA	1	0.7368	3.9	0.943	Contact Map
2auwA	2	0.3816	3.8	0.943	Contact Map
2k0qA	1	0.3092	3.5	0.944	Contact Map
2xdbA	1	0.7303	3	0.946	Contact Map
1mbyA	4	0.3487	2.5	0.948	Contact Map
4eo2A	3	0.5132	2	0.951	Contact Map
4parB	3	0.8289	1.9	0.951	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.