FlbD - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FlbD - Flagellar protein (FlbD)

PFAM:	PF06289	Sequences: MIKLTRLNGEEFVLNADLIETIEATPDTVITLTTGKKLVVRESVDEVIERVIEYRRRIF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	59 (58)
Sequences:	10146 (5702)
Seq/√Len:	748.6
META:	0.925

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_D	55_R	3.050	1.00
20_E	36_K	3.004	1.00
3_K	11_E	2.536	1.00
52_I	57_R	2.214	1.00
5_T	42_E	2.096	1.00
9_G	41_R	1.895	1.00
13_V	44_V	1.702	1.00
24_A	44_V	1.681	1.00
43_S	46_E	1.631	1.00
25_T	29_V	1.624	1.00
18_L	33_T	1.580	1.00
46_E	50_R	1.575	1.00
13_V	48_I	1.570	1.00
31_T	37_K	1.526	1.00
21_T	38_L	1.487	1.00
3_K	13_V	1.389	1.00
49_E	53_E	1.343	1.00
29_V	37_K	1.319	1.00
4_L	40_V	1.317	1.00
29_V	39_V	1.229	1.00
13_V	16_A	1.182	1.00
46_E	49_E	1.171	1.00
49_E	57_R	1.151	1.00
16_A	51_V	1.126	1.00
3_K	45_D	1.120	1.00
53_E	57_R	1.086	1.00
42_E	50_R	0.988	1.00
53_E	56_R	0.981	1.00
13_V	51_V	0.975	1.00
51_V	55_R	0.960	1.00
4_L	12_F	0.931	1.00
5_T	11_E	0.928	1.00
45_D	49_E	0.904	1.00
10_E	25_T	0.903	1.00
17_D	52_I	0.868	1.00
24_A	45_D	0.850	1.00
28_T	47_V	0.821	1.00
24_A	43_S	0.821	1.00
16_A	55_R	0.820	1.00
21_T	31_T	0.818	1.00
22_I	44_V	0.816	1.00
19_I	30_I	0.815	1.00
22_I	30_I	0.798	1.00
30_I	40_V	0.793	1.00
14_L	32_L	0.791	1.00
32_L	38_L	0.791	1.00
42_E	46_E	0.783	1.00
17_D	54_Y	0.773	1.00
23_E	37_K	0.772	1.00
4_L	47_V	0.767	1.00
18_L	34_T	0.766	1.00
6_R	23_E	0.754	1.00
16_A	54_Y	0.745	1.00
50_R	53_E	0.742	1.00
21_T	36_K	0.739	1.00
20_E	34_T	0.727	1.00
18_L	32_L	0.719	1.00
7_L	26_P	0.714	1.00
14_L	21_T	0.709	1.00
55_R	58_I	0.705	1.00
26_P	39_V	0.703	1.00
22_I	47_V	0.701	1.00
49_E	52_I	0.699	1.00
6_R	21_T	0.697	1.00
40_V	47_V	0.694	1.00
6_R	10_E	0.687	1.00
20_E	32_L	0.678	1.00
11_E	50_R	0.667	1.00
25_T	37_K	0.665	1.00
12_F	21_T	0.641	1.00
13_V	22_I	0.640	1.00
14_L	30_I	0.640	1.00
44_V	48_I	0.629	1.00
20_E	38_L	0.629	1.00
3_K	50_R	0.628	1.00
52_I	56_R	0.622	1.00
5_T	50_R	0.622	1.00
48_I	52_I	0.612	1.00
52_I	55_R	0.591	1.00
5_T	41_R	0.571	1.00
21_T	34_T	0.526	1.00
3_K	44_V	0.520	1.00
48_I	57_R	0.519	1.00
7_L	41_R	0.513	1.00
34_T	38_L	0.509	1.00
6_R	27_D	0.507	1.00
15_N	18_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4g4kA	1	0.9492	36.1	0.813	Contact Map
3d6wA	3	0.9831	31.3	0.819	Contact Map
4cbvA	2	0.9661	24.7	0.828	Contact Map
2ra2A	3	0.5085	18.9	0.837	Contact Map
2k57A	1	0.4576	16.3	0.842	Contact Map
2jn0A	1	0.4237	16	0.842	Contact Map
2p17A	1	0.6441	14.2	0.846	Contact Map
2rb6A	2	0.5085	12.7	0.85	Contact Map
5ajtA	2	0.9831	11.8	0.852	Contact Map
3bduA	3	0.4407	11.8	0.852	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.