DUF1013 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1013 - Protein of unknown function (DUF1013)

PFAM:	PF06242	Sequences: LEVQGIADGEVAQGIKGLDPIANGQLTREEIERCEADPNARLKLAKSKVPVPEKRKKGPRYTPVSKRQDRPDAIAWLLRNHPELKDAQISKLVGTTKPTIQAIRDRTHWNSANIKPRDPVTLGLCSQIDLDAAVEKAAK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	139 (138)
Sequences:	3306 (1172)
Seq/√Len:	99.8
META:	0.922

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_C	40_A	4.919	1.00
32_E	35_E	4.553	1.00
28_R	32_E	4.128	1.00
33_R	40_A	3.947	1.00
101_Q	105_D	3.869	1.00
5_G	11_V	3.315	1.00
32_E	36_A	3.080	1.00
72_D	117_R	2.939	1.00
34_C	42_L	2.740	1.00
77_L	84_L	2.718	1.00
98_P	102_A	2.583	1.00
30_E	33_R	2.554	1.00
18_L	25_Q	2.306	1.00
110_N	113_N	2.279	1.00
84_L	133_A	1.987	1.00
75_A	114_I	1.956	1.00
121_T	127_Q	1.839	1.00
30_E	40_A	1.738	1.00
6_I	12_A	1.724	1.00
27_T	45_A	1.709	1.00
25_Q	44_L	1.628	1.00
19_D	22_A	1.621	1.00
86_D	104_R	1.608	1.00
127_Q	131_D	1.588	1.00
4_Q	8_D	1.574	1.00
95_T	100_I	1.548	1.00
85_K	88_Q	1.534	1.00
109_W	113_N	1.497	1.00
31_I	35_E	1.494	1.00
85_K	90_S	1.484	1.00
50_P	55_R	1.469	1.00
103_I	111_S	1.420	1.00
91_K	133_A	1.374	0.99
117_R	121_T	1.328	0.99
118_D	127_Q	1.309	0.99
131_D	135_E	1.300	0.99
73_A	93_V	1.281	0.99
72_D	115_K	1.278	0.99
37_D	40_A	1.254	0.99
85_K	91_K	1.247	0.99
128_I	131_D	1.244	0.99
111_S	114_I	1.237	0.99
5_G	118_D	1.229	0.99
84_L	93_V	1.205	0.99
30_E	43_K	1.180	0.98
128_I	132_A	1.164	0.98
132_A	135_E	1.162	0.98
72_D	110_N	1.118	0.98
40_A	43_K	1.115	0.98
90_S	100_I	1.096	0.97
78_L	90_S	1.095	0.97
9_G	13_Q	1.088	0.97
70_R	93_V	1.085	0.97
111_S	117_R	1.078	0.97
108_H	114_I	1.071	0.97
28_R	35_E	1.056	0.97
106_R	111_S	1.055	0.97
34_C	41_R	1.034	0.96
83_E	138_A	1.029	0.96
18_L	23_N	1.021	0.96
120_V	127_Q	1.007	0.96
30_E	34_C	1.000	0.95
6_I	9_G	0.998	0.95
11_V	14_G	0.997	0.95
48_K	52_P	0.983	0.95
19_D	28_R	0.955	0.94
118_D	131_D	0.948	0.94
70_R	121_T	0.940	0.94
10_E	15_I	0.933	0.93
69_D	124_L	0.930	0.93
50_P	58_G	0.926	0.93
86_D	101_Q	0.919	0.93
131_D	138_A	0.918	0.93
10_E	14_G	0.900	0.92
55_R	58_G	0.895	0.92
90_S	95_T	0.885	0.91
29_E	32_E	0.875	0.91
38_P	41_R	0.853	0.90
107_T	113_N	0.848	0.90
46_K	50_P	0.843	0.89
77_L	93_V	0.842	0.89
77_L	103_I	0.839	0.89
26_L	42_L	0.833	0.89
135_E	138_A	0.831	0.89
118_D	128_I	0.824	0.88
9_G	14_G	0.824	0.88
31_I	34_C	0.820	0.88
13_Q	16_K	0.819	0.88
47_S	51_V	0.815	0.88
66_K	90_S	0.811	0.87
45_A	48_K	0.810	0.87
64_V	69_D	0.810	0.87
76_W	80_N	0.805	0.87
118_D	121_T	0.797	0.87
48_K	56_K	0.792	0.86
84_L	137_A	0.791	0.86
95_T	99_T	0.790	0.86
98_P	103_I	0.784	0.86
70_R	94_G	0.781	0.85
86_D	97_K	0.780	0.85
1_L	4_Q	0.762	0.84
24_G	45_A	0.761	0.84
132_A	136_K	0.752	0.83
126_S	129_D	0.745	0.83
79_R	116_P	0.741	0.82
87_A	90_S	0.729	0.81
75_A	116_P	0.728	0.81
115_K	121_T	0.726	0.81
28_R	76_W	0.725	0.81
120_V	131_D	0.717	0.80
76_W	81_H	0.714	0.80
85_K	115_K	0.711	0.80
33_R	42_L	0.700	0.79
121_T	128_I	0.699	0.78
72_D	75_A	0.695	0.78
98_P	101_Q	0.693	0.78
48_K	51_V	0.687	0.77
64_V	70_R	0.679	0.76
81_H	134_V	0.679	0.76
66_K	93_V	0.674	0.76
5_G	12_A	0.669	0.75
26_L	30_E	0.668	0.75
50_P	56_K	0.660	0.74
23_N	47_S	0.654	0.74
77_L	92_L	0.650	0.73
83_E	137_A	0.647	0.73
21_I	30_E	0.641	0.72
75_A	85_K	0.640	0.72
121_T	131_D	0.640	0.72
31_I	42_L	0.639	0.72
73_A	97_K	0.638	0.72
75_A	80_N	0.637	0.72
19_D	76_W	0.635	0.72
48_K	53_E	0.628	0.71
59_P	136_K	0.626	0.70
3_V	6_I	0.620	0.70
55_R	64_V	0.616	0.69
10_E	13_Q	0.615	0.69
49_V	52_P	0.615	0.69
16_K	64_V	0.612	0.69
109_W	118_D	0.609	0.68
68_Q	79_R	0.606	0.68
81_H	84_L	0.605	0.68
46_K	49_V	0.603	0.68
24_G	27_T	0.601	0.67
74_I	95_T	0.600	0.67
50_P	54_K	0.598	0.67
18_L	24_G	0.594	0.66
134_V	138_A	0.594	0.66
109_W	127_Q	0.590	0.66
78_L	101_Q	0.589	0.66
62_T	68_Q	0.585	0.65
117_R	138_A	0.585	0.65
21_I	26_L	0.584	0.65
85_K	133_A	0.584	0.65
5_G	127_Q	0.582	0.65
26_L	31_I	0.581	0.65
92_L	133_A	0.577	0.64
58_G	62_T	0.577	0.64
10_E	22_A	0.575	0.64
47_S	52_P	0.569	0.63
75_A	91_K	0.569	0.63
12_A	16_K	0.566	0.63
128_I	134_V	0.565	0.63
128_I	135_E	0.565	0.63
22_A	25_Q	0.564	0.62
50_P	53_E	0.563	0.62
129_D	132_A	0.563	0.62
61_Y	64_V	0.559	0.62
57_K	75_A	0.559	0.62
6_I	11_V	0.556	0.61
5_G	121_T	0.555	0.61
70_R	76_W	0.554	0.61
66_K	73_A	0.553	0.61
117_R	135_E	0.549	0.60
9_G	12_A	0.549	0.60
11_V	15_I	0.548	0.60
33_R	43_K	0.547	0.60
41_R	54_K	0.546	0.60
5_G	9_G	0.546	0.60
128_I	138_A	0.544	0.60
75_A	111_S	0.543	0.60
102_A	114_I	0.543	0.60
6_I	14_G	0.541	0.59
93_V	98_P	0.539	0.59
3_V	7_A	0.537	0.59
53_E	56_K	0.536	0.59
80_N	127_Q	0.535	0.58
121_T	138_A	0.534	0.58
4_Q	16_K	0.533	0.58
100_I	108_H	0.531	0.58
93_V	133_A	0.530	0.58
70_R	115_K	0.529	0.58
70_R	117_R	0.525	0.57
33_R	45_A	0.520	0.56
6_I	10_E	0.519	0.56
100_I	113_N	0.518	0.56
69_D	106_R	0.515	0.56
44_L	47_S	0.513	0.55
15_I	18_L	0.511	0.55
90_S	93_V	0.510	0.55
70_R	118_D	0.508	0.55
76_W	130_L	0.507	0.54
86_D	119_P	0.504	0.54
16_K	28_R	0.504	0.54
60_R	64_V	0.503	0.54
79_R	131_D	0.500	0.53

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2hoeA	2	0.4604	30.9	0.948	Contact Map
1z6rA	3	0.4604	28.2	0.949	Contact Map
3dn7A	2	0.4676	25.2	0.95	Contact Map
3dkwA	2	0.9281	23.7	0.951	Contact Map
2x48A	1	0.3885	21.4	0.952	Contact Map
1iufA	1	0.6187	21.4	0.952	Contact Map
4dyqA	5	0.482	20	0.953	Contact Map
1o5lA	2	0.4676	18.5	0.953	Contact Map
2i1qA	1	0.3669	17.7	0.954	Contact Map
1j9iA	2	0.3957	17.5	0.954	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.