DUF1002 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1002 - Protein of unknown function (DUF1002)

PFAM:	PF06207	Sequences: LGADLTEEQKAEVLKLFGVDEEDDVEVITVTNAEEHKYLGGYVSASQIGTRAISSAYITPLEKGSGINVETNNITWVTEEMYANALITAGVEDADVIVAAPFPVSGTAALTGIYKAYEEATGEKLDEEAKEVANEELVTTGELAEGIGSEKAAELIAEIKEEIAEGKPATEEEIRKIINEAAKELNITLTDEQIQQLVDLMEKISKLDIDWDQVKDQLEDV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	221 (219)
Sequences:	1193 (854)
Seq/√Len:	57.7
META:	0.538

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
190_T	193_Q	3.808	1.00
159_I	201_M	3.252	1.00
156_I	197_L	3.177	1.00
34_E	115_K	3.153	1.00
179_N	194_I	3.111	1.00
1_L	14_L	2.703	1.00
73_N	103_P	2.658	1.00
74_I	82_Y	2.641	1.00
171_E	202_E	2.639	1.00
193_Q	196_Q	2.563	1.00
52_A	108_A	2.505	1.00
59_T	95_D	2.505	1.00
175_R	179_N	2.501	1.00
68_N	95_D	2.422	1.00
210_D	213_Q	2.421	1.00
86_L	96_V	2.414	1.00
176_K	180_E	2.405	1.00
162_E	165_E	2.396	1.00
61_L	95_D	2.386	1.00
11_A	15_K	2.356	1.00
195_Q	199_D	2.200	1.00
16_L	99_A	2.061	1.00
10_K	21_E	2.041	1.00
10_K	29_T	1.994	1.00
197_L	201_M	1.980	1.00
191_D	195_Q	1.936	1.00
180_E	183_K	1.936	1.00
36_H	40_G	1.859	1.00
9_Q	102_F	1.850	1.00
171_E	175_R	1.840	1.00
170_T	173_E	1.818	0.99
125_L	129_A	1.817	0.99
17_F	97_I	1.815	0.99
135_E	203_K	1.805	0.99
136_E	160_K	1.804	0.99
14_L	27_V	1.752	0.99
74_I	98_V	1.714	0.99
146_G	193_Q	1.700	0.99
175_R	195_Q	1.681	0.99
7_E	11_A	1.673	0.99
75_T	103_P	1.664	0.99
13_V	99_A	1.633	0.99
100_A	104_V	1.626	0.99
12_E	15_K	1.625	0.99
32_N	36_H	1.622	0.99
172_E	176_K	1.605	0.99
118_E	130_K	1.603	0.99
179_N	183_K	1.591	0.99
80_E	83_A	1.584	0.98
65_S	93_D	1.580	0.98
64_G	93_D	1.572	0.98
178_I	198_V	1.571	0.98
62_E	65_S	1.552	0.98
173_E	176_K	1.538	0.98
72_N	99_A	1.508	0.98
43_V	47_Q	1.502	0.98
162_E	166_G	1.490	0.98
132_V	204_I	1.472	0.98
168_P	177_I	1.452	0.97
180_E	184_E	1.428	0.97
201_M	204_I	1.422	0.97
56_A	113_I	1.417	0.97
151_K	154_E	1.406	0.97
178_I	197_L	1.400	0.97
126_D	129_A	1.400	0.97
33_A	37_K	1.373	0.96
200_L	204_I	1.360	0.96
63_K	93_D	1.343	0.96
61_L	65_S	1.339	0.96
44_S	47_Q	1.316	0.95
82_Y	98_V	1.310	0.95
80_E	153_A	1.309	0.95
32_N	52_A	1.288	0.95
35_E	105_S	1.277	0.94
13_V	17_F	1.276	0.94
76_W	141_G	1.267	0.94
195_Q	198_V	1.256	0.94
3_A	31_T	1.234	0.93
212_D	216_D	1.225	0.93
92_E	213_Q	1.220	0.93
155_L	185_L	1.212	0.93
140_T	152_A	1.210	0.93
6_T	9_Q	1.207	0.93
91_V	94_A	1.201	0.92
158_E	185_L	1.181	0.92
180_E	186_N	1.162	0.91
36_H	45_A	1.149	0.91
105_S	108_A	1.140	0.90
156_I	200_L	1.128	0.90
199_D	202_E	1.126	0.90
70_E	97_I	1.120	0.89
8_E	11_A	1.117	0.89
53_I	100_A	1.106	0.89
135_E	139_T	1.105	0.89
1_L	55_S	1.105	0.89
144_A	149_S	1.100	0.89
168_P	173_E	1.091	0.88
111_T	130_K	1.069	0.87
56_A	98_V	1.058	0.87
31_T	52_A	1.046	0.86
35_E	107_T	1.037	0.85
148_G	152_A	1.030	0.85
216_D	219_E	1.010	0.84
134_N	137_L	1.005	0.84
13_V	101_P	1.003	0.83
17_F	57_Y	0.993	0.83
19_V	25_V	0.987	0.82
127_E	130_K	0.983	0.82
172_E	175_R	0.981	0.82
35_E	49_G	0.979	0.82
202_E	205_S	0.978	0.82
175_R	198_V	0.974	0.82
175_R	194_I	0.974	0.82
69_V	141_G	0.971	0.81
32_N	39_L	0.956	0.80
61_L	69_V	0.955	0.80
142_E	196_Q	0.955	0.80
158_E	161_E	0.951	0.80
147_I	152_A	0.950	0.80
124_K	172_E	0.929	0.78
77_V	134_N	0.916	0.77
179_N	191_D	0.907	0.77
32_N	35_E	0.903	0.76
158_E	184_E	0.903	0.76
191_D	194_I	0.897	0.76
38_Y	111_T	0.893	0.76
67_I	70_E	0.889	0.75
2_G	5_L	0.889	0.75
65_S	68_N	0.886	0.75
203_K	206_K	0.878	0.74
43_V	76_W	0.875	0.74
19_V	57_Y	0.873	0.74
161_E	165_E	0.873	0.74
8_E	12_E	0.869	0.74
192_E	199_D	0.867	0.73
148_G	151_K	0.857	0.73
152_A	155_L	0.856	0.72
35_E	52_A	0.854	0.72
84_N	136_E	0.853	0.72
10_K	27_V	0.848	0.72
47_Q	102_F	0.845	0.72
81_M	152_A	0.842	0.71
162_E	180_E	0.842	0.71
177_I	180_E	0.841	0.71
9_Q	12_E	0.838	0.71
7_E	172_E	0.832	0.70
171_E	198_V	0.830	0.70
159_I	177_I	0.829	0.70
188_T	191_D	0.828	0.70
35_E	48_I	0.828	0.70
144_A	152_A	0.821	0.69
42_Y	131_E	0.820	0.69
77_V	104_V	0.819	0.69
197_L	214_V	0.816	0.69
174_I	201_M	0.814	0.69
201_M	214_V	0.804	0.68
1_L	27_V	0.802	0.67
26_E	119_E	0.799	0.67
186_N	193_Q	0.795	0.67
32_N	48_I	0.791	0.66
156_I	174_I	0.788	0.66
174_I	177_I	0.783	0.66
76_W	107_T	0.783	0.66
168_P	174_I	0.781	0.65
154_E	158_E	0.780	0.65
88_T	136_E	0.775	0.65
4_D	49_G	0.774	0.65
178_I	202_E	0.770	0.64
84_N	87_I	0.763	0.64
201_M	205_S	0.762	0.64
12_E	16_L	0.761	0.63
10_K	14_L	0.756	0.63
71_T	99_A	0.754	0.63
214_V	218_L	0.752	0.62
178_I	193_Q	0.752	0.62
49_G	107_T	0.749	0.62
58_I	96_V	0.743	0.62
182_A	185_L	0.741	0.61
204_I	207_L	0.739	0.61
86_L	203_K	0.736	0.61
190_T	199_D	0.730	0.60
66_G	93_D	0.730	0.60
57_Y	97_I	0.726	0.60
77_V	205_S	0.725	0.60
176_K	179_N	0.719	0.59
209_I	217_Q	0.713	0.58
199_D	203_K	0.710	0.58
53_I	102_F	0.705	0.58
79_E	83_A	0.699	0.57
82_Y	116_A	0.699	0.57
86_L	113_I	0.698	0.57
84_N	160_K	0.696	0.57
99_A	141_G	0.695	0.56
163_I	201_M	0.692	0.56
178_I	182_A	0.692	0.56
211_W	214_V	0.689	0.56
32_N	49_G	0.687	0.56
139_T	144_A	0.687	0.56
56_A	108_A	0.683	0.55
61_L	68_N	0.681	0.55
145_E	216_D	0.681	0.55
27_V	31_T	0.679	0.55
5_L	9_Q	0.678	0.55
52_A	107_T	0.676	0.54
78_T	220_D	0.676	0.54
143_L	152_A	0.674	0.54
48_I	107_T	0.671	0.54
13_V	16_L	0.671	0.54
174_I	202_E	0.671	0.54
71_T	74_I	0.664	0.53
3_A	29_T	0.662	0.53
4_D	51_R	0.661	0.53
125_L	130_K	0.659	0.53
128_E	187_I	0.657	0.52
56_A	120_A	0.655	0.52
196_Q	199_D	0.653	0.52
144_A	147_I	0.647	0.51
8_E	33_A	0.642	0.51
81_M	86_L	0.642	0.51
114_Y	219_E	0.640	0.50
35_E	39_L	0.637	0.50
7_E	10_K	0.636	0.50
165_E	215_K	0.636	0.50
162_E	177_I	0.635	0.50
189_L	195_Q	0.635	0.50
129_A	204_I	0.633	0.50
12_E	72_N	0.631	0.49
87_I	217_Q	0.631	0.49
114_Y	211_W	0.630	0.49
127_E	131_E	0.625	0.49
135_E	172_E	0.622	0.48
98_V	113_I	0.622	0.48
25_V	186_N	0.621	0.48
169_A	173_E	0.620	0.48
172_E	198_V	0.618	0.48
46_S	93_D	0.618	0.48
15_K	190_T	0.617	0.48
143_L	193_Q	0.614	0.48
67_I	87_I	0.608	0.47
20_D	24_D	0.603	0.46
154_E	185_L	0.602	0.46
185_L	209_I	0.601	0.46
63_K	92_E	0.596	0.46
1_L	5_L	0.595	0.45
132_V	207_L	0.590	0.45
7_E	37_K	0.590	0.45
53_I	117_Y	0.586	0.44
163_I	177_I	0.586	0.44
114_Y	125_L	0.586	0.44
39_L	140_T	0.583	0.44
135_E	218_L	0.583	0.44
128_E	189_L	0.581	0.44
16_L	72_N	0.579	0.44
140_T	197_L	0.576	0.43
202_E	206_K	0.575	0.43
181_A	184_E	0.574	0.43
178_I	187_I	0.574	0.43
164_A	204_I	0.574	0.43
149_S	153_A	0.573	0.43
41_G	45_A	0.573	0.43
4_D	32_N	0.572	0.43
58_I	139_T	0.569	0.43
190_T	194_I	0.569	0.43
174_I	178_I	0.568	0.43
158_E	181_A	0.564	0.42
213_Q	216_D	0.560	0.42
76_W	108_A	0.559	0.42
30_V	34_E	0.559	0.42
131_E	135_E	0.559	0.42
147_I	187_I	0.558	0.41
67_I	113_I	0.557	0.41
44_S	123_E	0.557	0.41
151_K	171_E	0.557	0.41
150_E	154_E	0.557	0.41
183_K	188_T	0.557	0.41
91_V	114_Y	0.553	0.41
167_K	176_K	0.553	0.41
199_D	204_I	0.551	0.41
205_S	208_D	0.549	0.41
139_T	158_E	0.548	0.40
20_D	23_D	0.547	0.40
83_A	213_Q	0.545	0.40
174_I	188_T	0.544	0.40
9_Q	14_L	0.543	0.40
5_L	101_P	0.543	0.40
149_S	190_T	0.540	0.40
187_I	205_S	0.538	0.39
163_I	167_K	0.537	0.39
84_N	88_T	0.536	0.39
192_E	196_Q	0.535	0.39
209_I	214_V	0.535	0.39
77_V	81_M	0.535	0.39
38_Y	115_K	0.527	0.38
92_E	124_K	0.527	0.38
41_G	131_E	0.525	0.38
49_G	52_A	0.524	0.38
25_V	135_E	0.522	0.38
67_I	94_A	0.521	0.38
14_L	21_E	0.521	0.38
86_L	100_A	0.519	0.37
48_I	105_S	0.518	0.37
163_I	209_I	0.518	0.37
15_K	20_D	0.516	0.37
71_T	189_L	0.514	0.37
6_T	51_R	0.514	0.37
61_L	129_A	0.513	0.37
62_E	219_E	0.512	0.37
49_G	105_S	0.512	0.37
40_G	127_E	0.512	0.37
174_I	195_Q	0.511	0.37
72_N	100_A	0.510	0.36
159_I	204_I	0.509	0.36
168_P	171_E	0.508	0.36
69_V	98_V	0.508	0.36
11_A	18_G	0.507	0.36
184_E	215_K	0.506	0.36
49_G	76_W	0.506	0.36
187_I	193_Q	0.506	0.36
204_I	211_W	0.505	0.36
206_K	214_V	0.505	0.36
54_S	109_A	0.504	0.36
26_E	58_I	0.504	0.36
67_I	83_A	0.503	0.36
101_P	108_A	0.503	0.36
127_E	162_E	0.503	0.36
35_E	108_A	0.502	0.36
74_I	89_A	0.500	0.35
169_A	174_I	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2o36A	1	0.6471	49.3	0.947	Contact Map
2o3eA	1	0.7014	45.4	0.949	Contact Map
2i88A	1	0.3529	41.8	0.95	Contact Map
1m5yA	1	0.4434	39	0.951	Contact Map
4ka7A	1	0.6968	38.1	0.951	Contact Map
3kheA	1	0.6697	34.1	0.952	Contact Map
1ij5A	1	0.8371	23.7	0.956	Contact Map
3q5iA	1	0.6697	22.8	0.956	Contact Map
1colA	1	0.4118	22.6	0.956	Contact Map
3rgcA	2	0.3801	22.1	0.956	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.