DUF997 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF997 - Protein of unknown function (DUF997)

PFAM:	PF06196	Sequences: QARREALITLGLWLAYFVWWYGFAYGLGSGPPEEYYILGFPDWFFWSCVVPWIVFIVLVWLMVKFFFKDIPLEDEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	76 (75)
Sequences:	1402 (968)
Seq/√Len:	111.8
META:	0.71

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_F	49_V	2.630	1.00
7_L	11_G	2.349	1.00
32_P	35_Y	2.332	1.00
61_L	65_F	2.330	1.00
24_A	47_S	2.077	1.00
19_W	51_P	2.063	1.00
12_L	58_L	2.048	1.00
13_W	16_Y	1.892	1.00
1_Q	4_R	1.822	1.00
37_I	45_F	1.768	1.00
44_F	48_C	1.759	1.00
42_D	46_W	1.644	1.00
9_T	16_Y	1.620	1.00
8_I	66_F	1.549	1.00
23_F	27_L	1.508	1.00
3_R	7_L	1.458	1.00
24_A	27_L	1.444	1.00
52_W	56_I	1.436	1.00
64_K	67_F	1.436	1.00
62_M	67_F	1.423	1.00
24_A	29_S	1.409	1.00
40_F	45_F	1.362	1.00
22_G	26_G	1.359	1.00
63_V	67_F	1.357	1.00
11_G	15_A	1.316	1.00
36_Y	45_F	1.278	0.99
17_F	21_Y	1.230	0.99
60_W	64_K	1.197	0.99
44_F	47_S	1.191	0.99
18_V	22_G	1.187	0.99
59_V	62_M	1.180	0.99
17_F	20_W	1.138	0.99
24_A	28_G	1.123	0.98
11_G	18_V	1.111	0.98
1_Q	68_K	1.084	0.98
61_L	66_F	1.082	0.98
37_I	42_D	1.076	0.98
53_I	57_V	1.058	0.98
20_W	48_C	1.035	0.97
16_Y	20_W	1.004	0.97
16_Y	21_Y	0.999	0.97
44_F	51_P	0.993	0.97
13_W	20_W	0.991	0.97
21_Y	51_P	0.985	0.96
56_I	60_W	0.967	0.96
26_G	29_S	0.944	0.95
12_L	17_F	0.943	0.95
31_P	34_E	0.931	0.95
1_Q	69_D	0.911	0.94
15_A	22_G	0.911	0.94
14_L	18_V	0.894	0.94
71_P	75_E	0.886	0.94
13_W	17_F	0.882	0.93
64_K	68_K	0.876	0.93
2_A	6_A	0.839	0.92
16_Y	19_W	0.833	0.91
37_I	46_W	0.833	0.91
1_Q	70_I	0.824	0.91
62_M	66_F	0.815	0.90
45_F	50_V	0.814	0.90
57_V	61_L	0.809	0.90
25_Y	32_P	0.793	0.89
53_I	56_I	0.783	0.89
15_A	68_K	0.781	0.88
20_W	23_F	0.764	0.87
13_W	59_V	0.751	0.86
20_W	24_A	0.732	0.85
15_A	55_F	0.732	0.85
30_G	34_E	0.723	0.84
45_F	49_V	0.722	0.84
1_Q	9_T	0.722	0.84
48_C	51_P	0.716	0.84
6_A	9_T	0.705	0.83
23_F	54_V	0.703	0.83
19_W	24_A	0.702	0.83
13_W	48_C	0.691	0.82
58_L	62_M	0.690	0.81
63_V	66_F	0.686	0.81
16_Y	55_F	0.682	0.81
27_L	46_W	0.680	0.81
26_G	31_P	0.679	0.80
46_W	50_V	0.668	0.79
59_V	63_V	0.667	0.79
30_G	42_D	0.665	0.79
71_P	74_D	0.662	0.79
2_A	9_T	0.659	0.78
19_W	23_F	0.651	0.78
31_P	35_Y	0.634	0.76
50_V	54_V	0.630	0.75
6_A	72_L	0.626	0.75
36_Y	50_V	0.620	0.74
44_F	52_W	0.611	0.73
47_S	63_V	0.607	0.73
23_F	47_S	0.601	0.72
11_G	14_L	0.601	0.72
38_L	49_V	0.599	0.72
8_I	11_G	0.598	0.71
52_W	55_F	0.589	0.70
2_A	52_W	0.589	0.70
42_D	45_F	0.584	0.70
12_L	20_W	0.576	0.69
13_W	51_P	0.562	0.67
34_E	65_F	0.557	0.66
65_F	68_K	0.553	0.66
2_A	44_F	0.553	0.66
54_V	58_L	0.553	0.66
55_F	62_M	0.529	0.62
21_Y	25_Y	0.522	0.61
40_F	51_P	0.522	0.61
2_A	13_W	0.519	0.61
22_G	27_L	0.509	0.59
68_K	73_E	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2o9gA	3	0.8816	11.3	0.89	Contact Map
2kncA	1	0.6053	9.4	0.894	Contact Map
4aw6A	2	0.9342	8.8	0.895	Contact Map
4lz6A	1	0.8553	7.8	0.897	Contact Map
3w4tA	1	0.8816	6.5	0.901	Contact Map
3cn5A	3	0.8947	6.1	0.903	Contact Map
3dl8G	1	0.8816	5.8	0.903	Contact Map
2l8sA	1	0.5263	5.5	0.904	Contact Map
4il3A	1	0.9342	5.1	0.906	Contact Map
4i0uA	4	0.7895	4.9	0.907	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.