DUF992 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF992 - Protein of unknown function (DUF992)

PFAM:	PF06186	Sequences: VAAAAPAAAAQAGVKVGVLTCDVSGGVGFIIGSSKDLSCVFTPSGGGPPERYTGTIRKFGLDIGYTGGGVLVWAVFAPTSRLGPGALAGTYVGASAEATVGVGVGANVLVGGSNRSIALQPLSVEGQTGLNVAAGVASLTLR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	142 (138)
Sequences:	4624 (2737)
Seq/√Len:	233.0
META:	0.936

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
97_E	105_G	2.909	1.00
99_T	127_Q	2.862	1.00
8_A	11_Q	2.638	1.00
34_S	57_R	2.438	1.00
29_F	32_G	2.413	1.00
104_V	118_A	2.239	1.00
33_S	62_D	2.217	1.00
40_V	49_P	2.214	1.00
20_T	70_V	2.204	1.00
113_S	116_S	2.184	1.00
108_V	122_L	2.147	1.00
37_L	139_L	2.052	1.00
23_V	26_G	2.043	1.00
57_R	138_S	2.016	1.00
18_V	72_V	1.931	1.00
38_S	51_R	1.928	1.00
90_T	140_T	1.909	1.00
20_T	42_T	1.859	1.00
104_V	108_V	1.832	1.00
67_G	128_T	1.789	1.00
82_L	117_I	1.783	1.00
23_V	35_K	1.771	1.00
43_P	49_P	1.756	1.00
95_S	137_A	1.729	1.00
26_G	35_K	1.726	1.00
81_R	115_R	1.709	1.00
35_K	66_T	1.708	1.00
105_G	125_E	1.702	1.00
34_S	55_T	1.672	1.00
31_I	59_F	1.639	1.00
100_V	130_L	1.623	1.00
7_A	10_A	1.620	1.00
16_V	77_A	1.600	1.00
92_V	138_S	1.598	1.00
6_P	9_A	1.556	1.00
107_N	123_S	1.553	1.00
14_V	78_P	1.496	1.00
50_E	85_G	1.453	1.00
58_K	95_S	1.424	1.00
37_L	54_G	1.416	1.00
57_R	140_T	1.415	1.00
43_P	47_G	1.389	1.00
58_K	137_A	1.382	1.00
27_V	65_Y	1.364	1.00
15_K	44_S	1.357	1.00
9_A	12_A	1.352	1.00
18_V	74_A	1.343	1.00
22_D	70_V	1.296	1.00
23_V	71_L	1.292	1.00
40_V	51_R	1.268	1.00
42_T	49_P	1.261	1.00
23_V	37_L	1.238	1.00
69_G	125_E	1.231	1.00
7_A	11_Q	1.221	1.00
32_G	62_D	1.212	1.00
37_L	56_I	1.189	1.00
32_G	59_F	1.183	1.00
79_T	116_S	1.138	1.00
55_T	140_T	1.135	1.00
108_V	118_A	1.124	1.00
64_G	131_N	1.123	1.00
94_A	110_V	1.122	1.00
85_G	88_A	1.103	1.00
90_T	142_R	1.097	1.00
90_T	138_S	1.091	1.00
35_K	58_K	1.080	1.00
43_P	48_P	1.075	1.00
8_A	12_A	1.060	1.00
49_P	53_T	1.038	1.00
15_K	74_A	1.036	1.00
72_V	126_G	1.029	1.00
18_V	44_S	1.019	1.00
22_D	38_S	1.015	1.00
96_A	134_A	0.988	1.00
36_D	53_T	0.982	1.00
99_T	130_L	0.980	1.00
35_K	69_G	0.967	1.00
38_S	53_T	0.963	1.00
106_A	122_L	0.954	1.00
33_S	58_K	0.951	1.00
23_V	69_G	0.950	1.00
41_F	76_F	0.949	1.00
30_I	63_I	0.936	1.00
20_T	72_V	0.925	1.00
31_I	61_L	0.925	1.00
60_G	93_G	0.918	1.00
17_G	21_C	0.909	1.00
97_E	127_Q	0.906	1.00
43_P	50_E	0.891	0.99
95_S	107_N	0.866	0.99
13_G	76_F	0.862	0.99
50_E	84_P	0.862	0.99
58_K	133_A	0.862	0.99
28_G	64_G	0.857	0.99
97_E	107_N	0.850	0.99
45_G	48_P	0.845	0.99
24_S	36_D	0.840	0.99
6_P	10_A	0.835	0.99
77_A	86_A	0.834	0.99
96_A	106_A	0.826	0.99
44_S	47_G	0.826	0.99
22_D	68_G	0.825	0.99
77_A	116_S	0.816	0.99
5_A	8_A	0.816	0.99
23_V	54_G	0.815	0.99
81_R	84_P	0.806	0.99
5_A	10_A	0.793	0.99
24_S	54_G	0.791	0.99
68_G	128_T	0.787	0.99
54_G	69_G	0.780	0.99
132_V	135_G	0.780	0.99
21_C	39_C	0.778	0.99
110_V	118_A	0.757	0.98
56_I	137_A	0.757	0.98
66_T	99_T	0.755	0.98
29_F	34_S	0.749	0.98
28_G	66_T	0.747	0.98
74_A	122_L	0.736	0.98
98_A	102_V	0.732	0.98
22_D	40_V	0.731	0.98
83_G	114_N	0.730	0.98
13_G	118_A	0.729	0.98
5_A	11_Q	0.726	0.98
32_G	57_R	0.716	0.97
113_S	118_A	0.714	0.97
61_L	132_V	0.712	0.97
66_T	127_Q	0.701	0.97
100_V	104_V	0.700	0.97
15_K	45_G	0.692	0.97
95_S	123_S	0.686	0.97
15_K	18_V	0.683	0.97
99_T	131_N	0.681	0.97
36_D	55_T	0.678	0.96
29_F	57_R	0.673	0.96
36_D	67_G	0.660	0.96
59_F	138_S	0.659	0.96
32_G	64_G	0.657	0.96
28_G	105_G	0.654	0.96
81_R	86_A	0.649	0.96
94_A	108_V	0.648	0.95
41_F	45_G	0.645	0.95
133_A	136_V	0.644	0.95
61_L	65_Y	0.642	0.95
22_D	25_G	0.640	0.95
5_A	9_A	0.634	0.95
29_F	59_F	0.630	0.95
131_N	137_A	0.630	0.95
120_Q	123_S	0.629	0.95
80_S	114_N	0.626	0.95
50_E	82_L	0.621	0.94
48_P	84_P	0.611	0.94
46_G	115_R	0.601	0.93
24_S	69_G	0.600	0.93
79_T	82_L	0.600	0.93
99_T	129_G	0.597	0.93
97_E	133_A	0.597	0.93
109_L	139_L	0.593	0.93
30_I	62_D	0.593	0.93
25_G	65_Y	0.591	0.93
97_E	125_E	0.589	0.93
58_K	91_Y	0.586	0.92
96_A	103_G	0.583	0.92
40_V	70_V	0.582	0.92
38_S	54_G	0.580	0.92
70_V	74_A	0.576	0.92
88_A	114_N	0.574	0.92
56_I	73_W	0.569	0.91
7_A	12_A	0.567	0.91
89_G	112_G	0.563	0.91
42_T	46_G	0.562	0.91
5_A	12_A	0.562	0.91
25_G	67_G	0.555	0.90
33_S	129_G	0.555	0.90
29_F	56_I	0.555	0.90
71_L	136_V	0.554	0.90
93_G	105_G	0.553	0.90
32_G	58_K	0.551	0.90
71_L	95_S	0.551	0.90
28_G	131_N	0.550	0.90
42_T	45_G	0.544	0.89
64_G	107_N	0.543	0.89
24_S	27_V	0.541	0.89
16_V	41_F	0.541	0.89
72_V	124_V	0.535	0.89
6_P	12_A	0.532	0.88
13_G	78_P	0.529	0.88
24_S	38_S	0.527	0.88
45_G	80_S	0.527	0.88
57_R	90_T	0.526	0.88
88_A	113_S	0.524	0.88
73_W	123_S	0.522	0.87
40_V	43_P	0.520	0.87
103_G	123_S	0.519	0.87
49_P	83_G	0.519	0.87
71_L	133_A	0.518	0.87
33_S	93_G	0.516	0.87
33_S	63_I	0.515	0.87
77_A	117_I	0.515	0.87
59_F	136_V	0.514	0.87
13_G	25_G	0.514	0.87
94_A	98_A	0.511	0.86
25_G	56_I	0.505	0.86
15_K	84_P	0.502	0.85
35_K	97_E	0.501	0.85
127_Q	137_A	0.500	0.85
24_S	37_L	0.500	0.85
36_D	142_R	0.500	0.85

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4jj0A	4	0.0141	4.8	0.942	Contact Map
3wguG	1	0.1972	3.4	0.946	Contact Map
2imhA	2	0.4085	1.8	0.954	Contact Map
2m0sA	1	0.1972	1.5	0.956	Contact Map
3pguA	1	0.3873	1.2	0.958	Contact Map
3u0rA	1	0.0493	1	0.96	Contact Map
4nbqA	3	0.9437	1	0.96	Contact Map
3dwoX	1	0.3873	0.9	0.961	Contact Map
4ui9U	1	0.169	0.8	0.962	Contact Map
2yd6A	2	0.2817	0.8	0.962	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.