DUF983 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF983 - Protein of unknown function (DUF983)

PFAM:	PF06170	Sequences: FRGFLKMADRCPVCGLDFEREPGDDGPAYFVILIVGHIVVALALLVELAFDPPLWVHLALWLPLTLLLSLLLLRPSKGLWIALQW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	85 (84)
Sequences:	20330 (12558)
Seq/√Len:	1370.2
META:	0.935

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
71_L	75_P	2.377	1.00
10_R	15_G	2.186	1.00
45_L	49_A	2.134	1.00
10_R	17_D	2.112	1.00
2_R	8_A	2.078	1.00
57_H	61_W	2.066	1.00
53_P	56_V	1.966	1.00
8_A	12_P	1.954	1.00
55_W	59_A	1.867	1.00
16_L	20_R	1.824	1.00
9_D	19_E	1.691	1.00
3_G	6_K	1.686	1.00
46_V	50_F	1.662	1.00
59_A	63_P	1.645	1.00
54_L	58_L	1.621	1.00
33_L	37_H	1.617	1.00
2_R	6_K	1.596	1.00
17_D	20_R	1.556	1.00
56_V	59_A	1.546	1.00
7_M	81_I	1.506	1.00
32_I	36_G	1.496	1.00
78_G	82_A	1.416	1.00
29_Y	33_L	1.404	1.00
79_L	83_L	1.377	1.00
52_P	56_V	1.343	1.00
37_H	41_A	1.326	1.00
26_G	30_F	1.298	1.00
4_F	74_R	1.268	1.00
2_R	9_D	1.258	1.00
47_E	51_D	1.247	1.00
25_D	28_A	1.234	1.00
26_G	80_W	1.232	1.00
65_T	69_S	1.228	1.00
56_V	60_L	1.209	1.00
9_D	17_D	1.199	1.00
33_L	36_G	1.161	1.00
39_V	65_T	1.144	1.00
35_V	68_L	1.141	1.00
76_S	79_L	1.123	1.00
7_M	21_E	1.090	1.00
29_Y	32_I	1.082	1.00
21_E	24_D	1.071	1.00
45_L	48_L	1.057	1.00
58_L	62_L	1.034	1.00
68_L	72_L	1.030	1.00
52_P	57_H	1.026	1.00
31_V	76_S	0.986	1.00
8_A	18_F	0.972	1.00
26_G	31_V	0.962	1.00
44_L	48_L	0.958	1.00
30_F	76_S	0.956	1.00
47_E	50_F	0.920	1.00
21_E	84_Q	0.918	1.00
29_Y	37_H	0.915	1.00
80_W	84_Q	0.913	1.00
57_H	60_L	0.905	1.00
41_A	45_L	0.892	1.00
60_L	63_P	0.892	1.00
34_I	37_H	0.878	1.00
62_L	66_L	0.872	1.00
5_L	73_L	0.854	1.00
42_L	61_W	0.847	1.00
25_D	29_Y	0.845	1.00
35_V	72_L	0.842	1.00
49_A	52_P	0.841	1.00
69_S	73_L	0.835	1.00
69_S	72_L	0.834	1.00
74_R	77_K	0.829	1.00
30_F	33_L	0.828	1.00
81_I	84_Q	0.810	1.00
48_L	51_D	0.808	1.00
47_E	57_H	0.806	1.00
30_F	34_I	0.793	1.00
47_E	54_L	0.789	1.00
63_P	67_L	0.783	1.00
46_V	61_W	0.768	1.00
7_M	18_F	0.764	1.00
46_V	49_A	0.759	1.00
64_L	68_L	0.758	1.00
44_L	47_E	0.756	1.00
24_D	84_Q	0.753	1.00
59_A	62_L	0.752	1.00
28_A	31_V	0.747	1.00
75_P	78_G	0.744	1.00
54_L	59_A	0.738	1.00
45_L	50_F	0.737	1.00
38_I	42_L	0.720	1.00
16_L	81_I	0.720	1.00
30_F	80_W	0.714	1.00
23_G	27_P	0.707	1.00
73_L	77_K	0.706	1.00
40_V	43_A	0.705	1.00
23_G	81_I	0.703	1.00
72_L	76_S	0.684	1.00
35_V	69_S	0.682	1.00
76_S	80_W	0.677	1.00
79_L	82_A	0.671	1.00
58_L	61_W	0.666	1.00
39_V	43_A	0.665	1.00
80_W	83_L	0.662	1.00
24_D	81_I	0.651	1.00
47_E	52_P	0.639	1.00
21_E	81_I	0.638	1.00
31_V	35_V	0.630	1.00
32_I	35_V	0.607	1.00
40_V	44_L	0.598	1.00
19_E	23_G	0.576	1.00
61_W	64_L	0.575	1.00
46_V	57_H	0.570	1.00
42_L	46_V	0.566	1.00
39_V	64_L	0.564	1.00
54_L	57_H	0.558	1.00
57_H	62_L	0.556	1.00
46_V	52_P	0.547	1.00
42_L	45_L	0.545	1.00
34_I	76_S	0.541	1.00
19_E	22_P	0.539	1.00
39_V	61_W	0.535	1.00
70_L	74_R	0.534	1.00
62_L	65_T	0.527	1.00
28_A	32_I	0.523	1.00
3_G	8_A	0.518	1.00
50_F	57_H	0.515	1.00
36_G	40_V	0.514	1.00
3_G	74_R	0.504	1.00
67_L	70_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3nw0A	1	0.3412	61.9	0.808	Contact Map
2gmgA	1	0.3412	39.9	0.832	Contact Map
1i7dA	1	0.0824	32.8	0.839	Contact Map
2ectA	1	0.4	23.1	0.851	Contact Map
2ct0A	1	0.3529	22.6	0.851	Contact Map
1k82A	1	0.4235	21.7	0.852	Contact Map
2ecmA	1	0.2353	21.3	0.853	Contact Map
2ecyA	1	0.2824	20.9	0.854	Contact Map
2kizA	1	0.3059	20.7	0.854	Contact Map
2ma6A	1	0.3176	19	0.856	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.