PTAC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PTAC - Phosphate propanoyltransferase

PFAM:	PF06130	Sequences: EGVIVSARHIHLSPEDAEALFGYELTPKKDLSQPGQFADGETVTVVGPGERGLVFENVRVRGPPRFALQVHIDTDEANALGI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	82 (67)
Sequences:	13105 (5875)
Seq/√Len:	717.7
META:	0.892

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
16_D	68_L	3.477	1.00
17_A	64_P	3.044	1.00
44_T	56_E	2.959	1.00
14_P	18_E	2.502	1.00
14_P	64_P	2.336	1.00
13_S	16_D	2.296	1.00
53_L	80_L	2.182	1.00
45_V	70_V	2.173	1.00
63_P	66_F	1.979	1.00
42_T	57_N	1.849	1.00
42_T	59_R	1.825	1.00
53_L	56_E	1.694	1.00
44_T	53_L	1.673	1.00
12_L	60_V	1.607	1.00
38_A	59_R	1.594	1.00
12_L	68_L	1.558	1.00
10_I	43_V	1.366	1.00
46_V	53_L	1.313	1.00
13_S	67_A	1.294	1.00
22_G	41_E	1.285	1.00
7_A	59_R	1.270	1.00
21_F	60_V	1.237	1.00
7_A	76_E	1.210	1.00
7_A	42_T	1.177	1.00
16_D	19_A	1.145	1.00
13_S	68_L	1.136	1.00
74_T	78_N	1.129	1.00
55_F	80_L	1.107	1.00
8_R	76_E	1.075	1.00
74_T	77_A	1.048	1.00
16_D	67_A	1.028	1.00
45_V	58_V	1.025	1.00
52_G	79_A	1.024	1.00
46_V	54_V	1.021	1.00
5_V	51_R	1.018	1.00
52_G	56_E	0.993	1.00
39_D	62_G	0.984	1.00
44_T	54_V	0.983	1.00
46_V	56_E	0.969	1.00
15_E	18_E	0.954	1.00
12_L	20_L	0.939	1.00
48_P	52_G	0.929	1.00
52_G	57_N	0.908	1.00
15_E	19_A	0.899	1.00
62_G	66_F	0.881	1.00
72_I	77_A	0.860	1.00
17_A	62_G	0.847	1.00
10_I	70_V	0.838	1.00
58_V	70_V	0.790	1.00
73_D	77_A	0.752	1.00
49_G	52_G	0.739	1.00
5_V	81_G	0.727	1.00
72_I	80_L	0.711	1.00
46_V	52_G	0.708	1.00
47_G	82_I	0.703	1.00
12_L	21_F	0.696	1.00
21_F	43_V	0.686	1.00
43_V	60_V	0.677	1.00
8_R	55_F	0.676	1.00
51_R	81_G	0.656	1.00
14_P	62_G	0.644	1.00
73_D	79_A	0.640	1.00
7_A	50_E	0.635	1.00
18_E	22_G	0.632	1.00
7_A	57_N	0.617	1.00
50_E	57_N	0.613	1.00
16_D	20_L	0.607	1.00
56_E	79_A	0.603	1.00
47_G	52_G	0.599	1.00
65_R	69_Q	0.598	1.00
17_A	37_F	0.597	1.00
74_T	79_A	0.591	1.00
50_E	81_G	0.588	1.00
12_L	17_A	0.586	1.00
47_G	80_L	0.583	1.00
53_L	79_A	0.582	1.00
46_V	49_G	0.578	1.00
4_I	7_A	0.576	1.00
20_L	68_L	0.576	1.00
40_G	59_R	0.572	1.00
4_I	38_A	0.571	1.00
55_F	79_A	0.566	1.00
4_I	74_T	0.560	1.00
12_L	16_D	0.559	1.00
17_A	39_D	0.556	1.00
8_R	54_V	0.555	1.00
17_A	41_E	0.555	1.00
47_G	51_R	0.549	1.00
2_G	61_R	0.546	1.00
10_I	58_V	0.545	1.00
72_I	78_N	0.541	1.00
13_S	63_P	0.535	1.00
73_D	78_N	0.534	1.00
11_H	71_H	0.533	1.00
10_I	60_V	0.531	1.00
51_R	76_E	0.526	1.00
13_S	66_F	0.525	1.00
59_R	76_E	0.520	1.00
44_T	57_N	0.517	1.00
14_P	17_A	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ujsA	1	0.6341	31.4	0.876	Contact Map
2k6mS	1	0.561	27.1	0.88	Contact Map
1qzpA	1	0.561	26.1	0.881	Contact Map
1yu8X	1	0.561	26.1	0.881	Contact Map
2ff4A	2	0.7927	10.7	0.9	Contact Map
2iv2X	1	0.6585	9.8	0.902	Contact Map
3esmA	2	0.7073	7.5	0.907	Contact Map
3ounA	1	0.6951	6.5	0.91	Contact Map
2napA	1	0.7561	6.2	0.911	Contact Map
2e7zA	1	0.7561	5.8	0.912	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.