Phenol_hyd_sub - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Phenol_hyd_sub - Phenol hydroxylase subunit

PFAM:	PF06099	Sequences: QPAFDTLRRYVRVTGERADGFVEFEFAIGDPELFVELVLPRAAFEEFCAANRVVHLD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	57 (54)
Sequences:	723 (490)
Seq/√Len:	66.7
META:	0.787

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
14_T	25_E	3.155	1.00
16_E	41_R	3.078	1.00
13_V	44_F	2.833	1.00
40_P	43_A	2.480	1.00
23_E	30_D	1.819	1.00
48_C	53_V	1.783	1.00
41_R	45_E	1.750	1.00
14_T	37_L	1.722	1.00
8_R	54_V	1.700	0.99
4_F	30_D	1.695	0.99
15_G	19_D	1.649	0.99
9_R	51_N	1.647	0.99
25_E	34_F	1.574	0.99
34_F	37_L	1.475	0.99
14_T	35_V	1.443	0.98
7_L	10_Y	1.393	0.98
15_G	23_E	1.373	0.98
43_A	46_E	1.342	0.97
5_D	8_R	1.338	0.97
46_E	50_A	1.160	0.94
30_D	37_L	1.111	0.92
45_E	49_A	1.088	0.91
25_E	35_V	1.081	0.91
21_F	38_V	1.051	0.90
46_E	49_A	1.047	0.90
26_F	31_P	1.042	0.90
27_A	34_F	1.037	0.89
27_A	31_P	1.030	0.89
10_Y	28_I	0.995	0.87
30_D	34_F	0.992	0.87
27_A	56_L	0.990	0.87
11_V	48_C	0.933	0.84
42_A	46_E	0.916	0.82
20_G	56_L	0.908	0.82
44_F	48_C	0.880	0.80
9_R	53_V	0.872	0.79
23_E	38_V	0.862	0.78
42_A	45_E	0.849	0.77
9_R	21_F	0.792	0.72
9_R	54_V	0.773	0.70
26_F	35_V	0.772	0.70
13_V	45_E	0.737	0.67
39_L	43_A	0.733	0.66
9_R	31_P	0.724	0.65
15_G	20_G	0.717	0.65
21_F	40_P	0.716	0.65
11_V	28_I	0.709	0.64
15_G	18_A	0.708	0.64
9_R	26_F	0.704	0.63
27_A	54_V	0.703	0.63
23_E	34_F	0.673	0.60
3_A	22_V	0.659	0.58
17_R	20_G	0.657	0.58
42_A	52_R	0.654	0.58
30_D	38_V	0.654	0.58
10_Y	27_A	0.646	0.57
29_G	52_R	0.635	0.55
13_V	16_E	0.629	0.55
49_A	52_R	0.618	0.53
12_R	25_E	0.617	0.53
16_E	32_E	0.615	0.53
43_A	51_N	0.608	0.52
22_V	41_R	0.602	0.51
17_R	30_D	0.600	0.51
12_R	42_A	0.586	0.50
33_L	50_A	0.582	0.49
30_D	44_F	0.580	0.49
17_R	38_V	0.578	0.49
28_I	51_N	0.572	0.48
14_T	27_A	0.558	0.46
33_L	54_V	0.551	0.45
22_V	50_A	0.551	0.45
11_V	16_E	0.549	0.45
9_R	29_G	0.536	0.44
18_A	41_R	0.535	0.44
4_F	7_L	0.526	0.43
21_F	53_V	0.519	0.42
36_E	44_F	0.511	0.41
3_A	7_L	0.510	0.41
36_E	52_R	0.505	0.40
16_E	45_E	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2o34A	1	1	12.2	0.889	Contact Map
3ng0A	5	0.3333	4.2	0.91	Contact Map
1eswA	1	0.9298	4.1	0.911	Contact Map
3zdfC	1	0.3158	3.7	0.912	Contact Map
3biyA	1	0.8596	3.7	0.912	Contact Map
4bhwA	2	1	3.5	0.914	Contact Map
4bgpA	1	0.5439	3.2	0.915	Contact Map
3doaA	1	0.8246	3.1	0.916	Contact Map
4mo3M	1	0.5789	3.1	0.916	Contact Map
1werA	1	0.3333	3.1	0.916	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.