CreA - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CreA - CreA protein

PFAM:	PF05981	Sequences: IGSVSTVFKLLGPNDKIVVEAFDDPKVPGVTCHVSRAKTGGIKGALGLAEDPSDASIACRQTGPITFKGKLPKSKDGEEVFSERRSLLFKKLRVVRIYDAKRNTLVYLAYSDKLIEGSPKNSISTVPIMPW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	131 (127)
Sequences:	2691 (818)
Seq/√Len:	72.6
META:	0.809

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_K	78_E	4.036	1.00
28_P	66_T	3.403	1.00
23_D	102_R	3.258	1.00
33_H	125_T	3.099	1.00
13_P	45_A	3.021	1.00
5_S	14_N	2.892	1.00
7_V	15_D	2.835	1.00
21_A	31_T	2.795	1.00
85_R	92_L	2.628	1.00
31_T	62_T	2.619	1.00
30_V	126_V	2.430	1.00
9_K	15_D	2.366	1.00
95_V	110_Y	2.267	1.00
28_P	68_K	2.137	1.00
3_S	18_V	2.072	1.00
44_G	49_A	2.059	1.00
12_G	42_I	2.051	1.00
13_P	16_K	2.012	1.00
4_V	108_L	1.926	1.00
42_I	46_L	1.924	1.00
54_D	120_K	1.897	1.00
21_A	102_R	1.879	1.00
77_G	97_I	1.800	1.00
19_V	97_I	1.762	1.00
5_S	8_F	1.690	1.00
79_E	93_R	1.680	1.00
28_P	67_F	1.648	1.00
7_V	116_E	1.595	0.99
93_R	112_D	1.586	0.99
42_I	45_A	1.570	0.99
5_S	15_D	1.448	0.99
56_S	60_R	1.446	0.99
100_A	103_N	1.420	0.99
61_Q	65_I	1.405	0.98
5_S	16_K	1.372	0.98
72_P	77_G	1.338	0.98
39_T	51_D	1.321	0.98
76_D	100_A	1.320	0.98
87_L	113_K	1.274	0.97
21_A	33_H	1.263	0.97
36_R	85_R	1.243	0.97
27_V	105_L	1.237	0.97
58_A	104_T	1.175	0.95
31_T	102_R	1.172	0.95
88_L	92_L	1.126	0.94
7_V	10_L	1.124	0.94
41_G	44_G	1.101	0.93
82_S	93_R	1.098	0.93
92_L	109_A	1.094	0.93
106_V	123_I	1.073	0.93
94_V	97_I	1.036	0.91
22_F	34_V	1.027	0.91
82_S	91_K	1.018	0.90
23_D	31_T	1.014	0.90
9_K	12_G	0.990	0.89
29_G	61_Q	0.970	0.88
39_T	49_A	0.943	0.87
15_D	39_T	0.940	0.87
46_L	116_E	0.932	0.86
103_N	128_I	0.931	0.86
88_L	114_L	0.916	0.85
37_A	51_D	0.915	0.85
32_C	59_C	0.911	0.85
51_D	85_R	0.892	0.84
104_T	125_T	0.883	0.83
125_T	129_M	0.880	0.83
36_R	92_L	0.870	0.82
3_S	7_V	0.869	0.82
113_K	116_E	0.851	0.81
43_K	49_A	0.846	0.80
83_E	93_R	0.842	0.80
37_A	52_P	0.833	0.79
20_E	36_R	0.826	0.79
10_L	13_P	0.825	0.78
34_V	94_V	0.825	0.78
48_L	87_L	0.824	0.78
52_P	55_A	0.817	0.78
70_K	98_Y	0.806	0.77
1_I	5_S	0.801	0.76
8_F	13_P	0.800	0.76
66_T	69_G	0.797	0.76
27_V	30_V	0.795	0.76
110_Y	120_K	0.794	0.76
71_L	98_Y	0.790	0.75
18_V	38_K	0.788	0.75
39_T	43_K	0.777	0.74
98_Y	103_N	0.777	0.74
36_R	55_A	0.775	0.74
5_S	13_P	0.775	0.74
37_A	85_R	0.774	0.74
26_K	80_V	0.770	0.74
112_D	120_K	0.761	0.73
22_F	94_V	0.750	0.72
31_T	101_K	0.748	0.71
28_P	69_G	0.744	0.71
38_K	85_R	0.743	0.71
14_N	45_A	0.743	0.71
60_R	124_S	0.743	0.71
11_L	15_D	0.741	0.71
15_D	42_I	0.739	0.70
26_K	69_G	0.739	0.70
87_L	114_L	0.737	0.70
37_A	55_A	0.723	0.69
7_V	12_G	0.722	0.69
118_S	124_S	0.720	0.68
57_I	109_A	0.713	0.68
55_A	120_K	0.713	0.68
33_H	123_I	0.707	0.67
101_K	104_T	0.706	0.67
37_A	119_P	0.702	0.66
39_T	48_L	0.701	0.66
61_Q	128_I	0.698	0.66
70_K	101_K	0.684	0.64
84_R	91_K	0.679	0.64
30_V	105_L	0.674	0.63
83_E	92_L	0.674	0.63
69_G	98_Y	0.673	0.63
79_E	91_K	0.671	0.63
7_V	14_N	0.669	0.63
53_S	90_K	0.668	0.63
9_K	39_T	0.664	0.62
26_K	71_L	0.662	0.62
33_H	62_T	0.657	0.61
27_V	67_F	0.656	0.61
23_D	101_K	0.654	0.61
82_S	108_L	0.653	0.61
43_K	46_L	0.640	0.59
7_V	114_L	0.632	0.58
29_G	63_G	0.627	0.58
36_R	110_Y	0.627	0.58
62_T	104_T	0.624	0.57
55_A	88_L	0.621	0.57
46_L	87_L	0.617	0.57
21_A	34_V	0.611	0.56
6_T	16_K	0.611	0.56
68_K	71_L	0.611	0.56
96_R	99_D	0.608	0.55
54_D	118_S	0.608	0.55
15_D	48_L	0.606	0.55
82_S	111_S	0.602	0.55
52_P	120_K	0.596	0.54
41_G	60_R	0.595	0.54
81_F	94_V	0.591	0.53
72_P	76_D	0.590	0.53
8_F	12_G	0.589	0.53
13_P	40_G	0.583	0.52
43_K	87_L	0.582	0.52
112_D	118_S	0.577	0.52
82_S	98_Y	0.576	0.52
20_E	67_F	0.574	0.51
29_G	65_I	0.573	0.51
40_G	119_P	0.573	0.51
11_L	14_N	0.572	0.51
115_I	119_P	0.570	0.51
79_E	84_R	0.564	0.50
106_V	125_T	0.563	0.50
76_D	98_Y	0.562	0.50
57_I	92_L	0.562	0.50
52_P	84_R	0.560	0.50
91_K	112_D	0.559	0.49
86_S	113_K	0.558	0.49
66_T	101_K	0.558	0.49
17_I	38_K	0.553	0.49
21_A	62_T	0.552	0.49
36_R	83_E	0.548	0.48
55_A	92_L	0.548	0.48
35_S	55_A	0.544	0.48
27_V	66_T	0.544	0.48
91_K	110_Y	0.540	0.47
8_F	15_D	0.538	0.47
4_V	17_I	0.532	0.46
67_F	103_N	0.531	0.46
10_L	15_D	0.528	0.46
26_K	66_T	0.527	0.46
95_V	108_L	0.525	0.45
16_K	38_K	0.522	0.45
98_Y	128_I	0.521	0.45
15_D	37_A	0.517	0.44
70_K	100_A	0.516	0.44
68_K	72_P	0.515	0.44
6_T	13_P	0.513	0.44
26_K	72_P	0.512	0.44
85_R	126_V	0.509	0.43
25_P	46_L	0.506	0.43
35_S	111_S	0.506	0.43
2_G	17_I	0.505	0.43
122_S	125_T	0.504	0.43
45_A	48_L	0.503	0.43
39_T	46_L	0.501	0.42
14_N	17_I	0.500	0.42

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3c75H	2	0.7863	10	0.95	Contact Map
3cnkA	2	0.5802	4.7	0.957	Contact Map
1v18B	1	0.1985	3.9	0.959	Contact Map
3kmhA	2	0.3053	3.7	0.959	Contact Map
2ljuA	1	0.3511	2.3	0.963	Contact Map
3bdkA	2	0.9084	2.3	0.963	Contact Map
2dlgA	1	0.7252	2.3	0.963	Contact Map
2dgyA	1	0.4733	2	0.964	Contact Map
2if6A	1	0.4198	2	0.965	Contact Map
2bopA	2	0.313	1.9	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.