Phage_min_tail - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Phage_min_tail - Phage minor tail protein

PFAM:	PF05939	Sequences: ETFTWTPDYGASKSSKPRVRTAQFGDGYEQRAADGINNNLKSWSLTFNGREAEADAIEAFLDARAGVESFDWTPPDEGTTGKFVCDSWSKTYVGGNVYTITATFEQVF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	108 (105)
Sequences:	2963 (2339)
Seq/√Len:	228.3
META:	0.804

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_R	84_V	2.859	1.00
86_D	105_E	2.556	1.00
18_R	34_D	2.552	1.00
64_R	68_E	2.438	1.00
39_N	62_D	2.296	1.00
21_T	86_D	2.067	1.00
85_C	102_A	2.051	1.00
54_A	100_I	2.041	1.00
23_Q	29_E	1.995	1.00
43_W	72_W	1.957	1.00
16_K	87_S	1.926	1.00
21_T	29_E	1.910	1.00
71_D	80_T	1.901	1.00
50_R	53_E	1.804	1.00
41_K	106_Q	1.787	1.00
71_D	82_K	1.765	1.00
42_S	103_T	1.720	1.00
20_R	34_D	1.709	1.00
84_V	105_E	1.610	1.00
17_P	88_W	1.586	1.00
62_D	88_W	1.539	1.00
29_E	105_E	1.497	1.00
73_T	80_T	1.491	1.00
42_S	105_E	1.481	1.00
81_G	106_Q	1.474	1.00
7_P	47_F	1.446	1.00
14_S	87_S	1.399	1.00
29_E	84_V	1.363	1.00
90_K	98_Y	1.351	1.00
58_E	62_D	1.338	1.00
33_A	67_V	1.324	1.00
93_V	99_T	1.307	1.00
59_A	63_A	1.282	1.00
55_D	59_A	1.277	1.00
7_P	45_L	1.238	1.00
40_L	106_Q	1.238	1.00
12_S	89_S	1.206	1.00
8_D	48_N	1.205	1.00
33_A	38_N	1.204	1.00
51_E	98_Y	1.192	1.00
58_E	90_K	1.183	1.00
13_K	58_E	1.181	1.00
91_T	99_T	1.171	1.00
60_F	64_R	1.164	1.00
15_S	39_N	1.151	1.00
14_S	42_S	1.144	1.00
44_S	103_T	1.143	1.00
54_A	90_K	1.128	1.00
5_W	56_A	1.122	1.00
58_E	88_W	1.119	1.00
53_E	56_A	1.116	1.00
77_E	81_G	1.095	1.00
20_R	32_A	1.094	1.00
31_R	107_V	1.077	1.00
74_P	77_E	1.066	1.00
63_A	68_E	1.064	1.00
85_C	104_F	1.051	1.00
57_I	100_I	1.042	1.00
25_G	28_Y	1.022	1.00
58_E	100_I	1.010	1.00
17_P	39_N	1.003	1.00
11_A	43_W	1.001	1.00
54_A	98_Y	0.993	1.00
74_P	83_F	0.983	1.00
18_R	40_L	0.975	1.00
33_A	65_A	0.972	1.00
18_R	23_Q	0.955	1.00
84_V	107_V	0.929	1.00
15_S	62_D	0.893	0.99
49_G	54_A	0.885	0.99
14_S	44_S	0.882	0.99
85_C	88_W	0.870	0.99
73_T	79_T	0.868	0.99
13_K	43_W	0.868	0.99
46_T	101_T	0.863	0.99
21_T	31_R	0.857	0.99
60_F	70_F	0.851	0.99
24_F	30_Q	0.839	0.99
41_K	62_D	0.836	0.99
70_F	85_C	0.826	0.99
61_L	85_C	0.826	0.99
94_G	97_V	0.824	0.99
46_T	99_T	0.822	0.99
16_K	40_L	0.816	0.99
17_P	40_L	0.811	0.99
29_E	86_D	0.811	0.99
41_K	81_G	0.805	0.99
51_E	55_D	0.794	0.99
22_A	32_A	0.789	0.99
43_W	74_P	0.788	0.99
89_S	101_T	0.766	0.98
87_S	103_T	0.761	0.98
9_Y	95_G	0.759	0.98
56_A	59_A	0.748	0.98
15_S	41_K	0.744	0.98
19_V	38_N	0.744	0.98
14_S	89_S	0.743	0.98
65_A	68_E	0.738	0.98
48_N	99_T	0.734	0.98
61_L	102_A	0.722	0.97
95_G	98_Y	0.717	0.97
72_W	83_F	0.712	0.97
8_D	11_A	0.712	0.97
46_T	49_G	0.699	0.97
76_D	98_Y	0.691	0.97
69_S	82_K	0.687	0.97
94_G	98_Y	0.685	0.96
25_G	30_Q	0.684	0.96
3_F	57_I	0.684	0.96
74_P	78_G	0.679	0.96
21_T	105_E	0.677	0.96
26_D	36_I	0.675	0.96
51_E	96_N	0.663	0.96
16_K	42_S	0.662	0.96
22_A	30_Q	0.658	0.96
22_A	34_D	0.658	0.96
47_F	57_I	0.655	0.95
52_A	59_A	0.653	0.95
38_N	65_A	0.644	0.95
25_G	37_N	0.633	0.95
49_G	53_E	0.629	0.94
64_R	85_C	0.628	0.94
15_S	58_E	0.624	0.94
48_N	97_V	0.623	0.94
23_Q	40_L	0.617	0.94
39_N	88_W	0.612	0.94
61_L	100_I	0.605	0.93
54_A	57_I	0.604	0.93
44_S	101_T	0.599	0.93
74_P	81_G	0.584	0.92
72_W	104_F	0.584	0.92
55_D	90_K	0.582	0.92
41_K	74_P	0.579	0.92
6_T	9_Y	0.579	0.92
10_G	91_T	0.575	0.91
43_W	83_F	0.575	0.91
74_P	79_T	0.574	0.91
47_F	102_A	0.569	0.91
11_A	83_F	0.559	0.90
72_W	75_P	0.558	0.90
12_S	91_T	0.550	0.89
69_S	107_V	0.547	0.89
15_S	88_W	0.539	0.88
16_K	86_D	0.537	0.88
74_P	80_T	0.529	0.87
41_K	83_F	0.527	0.87
8_D	49_G	0.526	0.87
3_F	47_F	0.526	0.87
59_A	79_T	0.525	0.87
26_D	35_G	0.522	0.87
25_G	36_I	0.521	0.87
19_V	66_G	0.518	0.86
43_W	75_P	0.512	0.86
5_W	57_I	0.510	0.86
43_W	81_G	0.505	0.85
32_A	38_N	0.505	0.85
73_T	78_G	0.500	0.84
32_A	67_V	0.500	0.84

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2axcA	1	0.4352	4.5	0.92	Contact Map
4pqqA	1	0.9444	3.7	0.924	Contact Map
4jmqA	1	0.8333	2.9	0.927	Contact Map
2gnoA	1	0.5278	2.4	0.931	Contact Map
3c7fA	1	0.8611	2.1	0.932	Contact Map
2giaA	1	0.3056	2	0.933	Contact Map
4aanA	2	0.7222	1.9	0.934	Contact Map
2w1sA	1	0.9352	1.8	0.935	Contact Map
1xgkA	1	0.4074	1.7	0.936	Contact Map
2ia1A	2	0.7222	1.6	0.937	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.