Self-incomp_S1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Self-incomp_S1 - Plant self-incompatibility protein S1

PFAM:	PF05938	Sequences: HVHITNDLGNGKPLTVHCKSKDDDLGVHVLPPGQSFSFSFRPNFFGTTLFFCSFWWGNKHHSFDVYKAKRDDDRCGKLCIWSAREDGIYLFNNDNGPWEKCYPW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	104 (103)
Sequences:	1588 (1299)
Seq/√Len:	128.0
META:	0.064

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_H	24_D	3.857	1.00
43_N	47_T	3.411	1.00
75_C	79_C	3.294	1.00
64_D	67_K	2.538	1.00
89_Y	101_C	2.340	1.00
100_K	103_P	2.327	1.00
54_F	65_V	2.227	1.00
8_L	14_L	2.203	1.00
31_P	34_Q	2.133	1.00
83_A	88_I	2.125	1.00
3_H	35_S	2.084	1.00
19_K	51_F	1.972	1.00
16_V	28_H	1.916	1.00
7_D	82_S	1.892	1.00
20_S	50_F	1.880	1.00
20_S	23_D	1.834	1.00
42_P	66_Y	1.833	1.00
7_D	84_R	1.759	1.00
54_F	88_I	1.734	1.00
3_H	37_S	1.729	1.00
23_D	48_T	1.681	1.00
49_L	64_D	1.642	1.00
86_D	89_Y	1.608	1.00
42_P	68_A	1.554	1.00
25_L	50_F	1.551	1.00
14_L	54_F	1.476	1.00
21_K	49_L	1.465	1.00
23_D	40_F	1.417	1.00
9_G	85_E	1.377	1.00
15_T	27_V	1.372	1.00
3_H	80_I	1.368	1.00
14_L	83_A	1.360	1.00
15_T	29_V	1.338	1.00
25_L	28_H	1.306	1.00
13_P	29_V	1.296	1.00
13_P	31_P	1.279	1.00
16_V	36_F	1.266	1.00
21_K	51_F	1.209	0.99
19_K	49_L	1.180	0.99
23_D	50_F	1.171	0.99
53_S	60_H	1.114	0.99
12_K	85_E	1.088	0.99
5_T	80_I	1.074	0.99
53_S	62_S	1.046	0.98
71_D	74_R	1.028	0.98
51_F	62_S	1.007	0.98
28_H	36_F	1.002	0.98
83_A	89_Y	0.999	0.98
86_D	100_K	0.997	0.98
10_N	32_P	0.984	0.98
9_G	12_K	0.967	0.97
17_H	26_G	0.963	0.97
20_S	40_F	0.944	0.97
72_D	75_C	0.944	0.97
47_T	68_A	0.939	0.97
30_L	34_Q	0.937	0.97
17_H	25_L	0.927	0.97
54_F	101_C	0.916	0.96
91_F	94_D	0.906	0.96
22_D	48_T	0.905	0.96
51_F	64_D	0.903	0.96
97_P	100_K	0.898	0.96
20_S	48_T	0.898	0.96
27_V	55_W	0.894	0.96
92_N	95_N	0.893	0.96
74_R	90_L	0.888	0.96
7_D	33_G	0.884	0.96
4_I	36_F	0.881	0.95
25_L	48_T	0.876	0.95
22_D	40_F	0.863	0.95
4_I	54_F	0.859	0.95
46_G	68_A	0.849	0.94
54_F	83_A	0.832	0.94
82_S	98_W	0.823	0.93
84_R	89_Y	0.818	0.93
9_G	32_P	0.814	0.93
91_F	98_W	0.791	0.92
12_K	59_K	0.776	0.91
12_K	56_W	0.760	0.90
90_L	93_N	0.755	0.90
19_K	24_D	0.752	0.90
30_L	36_F	0.751	0.90
28_H	39_S	0.750	0.90
22_D	50_F	0.730	0.89
12_K	57_G	0.714	0.88
40_F	66_Y	0.712	0.87
17_H	20_S	0.709	0.87
49_L	53_S	0.706	0.87
38_F	50_F	0.704	0.87
84_R	87_G	0.703	0.87
19_K	62_S	0.697	0.86
14_L	81_W	0.688	0.86
8_L	56_W	0.684	0.85
16_V	30_L	0.666	0.84
41_R	45_F	0.666	0.84
24_D	79_C	0.663	0.83
92_N	98_W	0.661	0.83
99_E	102_Y	0.659	0.83
19_K	64_D	0.659	0.83
55_W	60_H	0.655	0.83
21_K	48_T	0.648	0.82
75_C	78_L	0.638	0.81
37_S	41_R	0.634	0.81
66_Y	94_D	0.633	0.80
49_L	67_K	0.629	0.80
12_K	32_P	0.628	0.80
63_F	66_Y	0.625	0.80
6_N	52_C	0.624	0.80
42_P	73_D	0.619	0.79
25_L	36_F	0.617	0.79
25_L	40_F	0.613	0.78
98_W	102_Y	0.608	0.78
5_T	35_S	0.598	0.77
94_D	98_W	0.595	0.76
5_T	82_S	0.592	0.76
69_K	77_K	0.590	0.76
4_I	38_F	0.589	0.76
72_D	76_G	0.587	0.75
73_D	76_G	0.585	0.75
7_D	92_N	0.582	0.75
30_L	85_E	0.575	0.74
74_R	99_E	0.571	0.73
29_V	83_A	0.570	0.73
17_H	48_T	0.565	0.73
98_W	101_C	0.564	0.72
19_K	53_S	0.563	0.72
15_T	36_F	0.561	0.72
96_G	99_E	0.556	0.71
54_F	89_Y	0.555	0.71
43_N	48_T	0.554	0.71
78_L	93_N	0.550	0.71
63_F	88_I	0.548	0.70
36_F	85_E	0.545	0.70
29_V	77_K	0.541	0.69
43_N	66_Y	0.541	0.69
42_P	45_F	0.540	0.69
6_N	18_C	0.538	0.69
33_G	55_W	0.529	0.68
90_L	101_C	0.528	0.67
13_P	57_G	0.526	0.67
46_G	69_K	0.525	0.67
51_F	54_F	0.525	0.67
20_S	25_L	0.522	0.67
89_Y	100_K	0.519	0.66
61_H	81_W	0.516	0.66
10_N	82_S	0.512	0.65
70_R	74_R	0.511	0.65
71_D	75_C	0.511	0.65
9_G	33_G	0.511	0.65
13_P	32_P	0.510	0.65
65_V	70_R	0.507	0.64
92_N	97_P	0.504	0.64
76_G	93_N	0.502	0.64
92_N	96_G	0.500	0.63

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3c75A	1	0.6058	42.3	0.87	Contact Map
2ov0A	1	0.6058	31.3	0.879	Contact Map
4knuA	3	0.8365	28.3	0.882	Contact Map
3cvbA	1	0.6442	26	0.884	Contact Map
3wkqA	3	0.9808	22	0.888	Contact Map
1id2A	1	0.6058	20.1	0.89	Contact Map
2xu9A	1	0.8462	18.8	0.891	Contact Map
3ziyA	3	0.9808	18.6	0.891	Contact Map
2aanA	2	0.6346	18.3	0.892	Contact Map
3gdcA	3	0.9904	17.9	0.892	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.