DUF814 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF814 - Domain of unknown function (DUF814)

PFAM:	PF05670	Sequences: WFISSDGFLILVGRNAKQNDELTFKLARPNDLWLHAKGIPGSHVILRTPGGEEPPPTLEEAAQLAAYYSKAARNSGKVPVDYTQRKYVKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	90 (86)
Sequences:	20839 (12893)
Seq/√Len:	1390.3
META:	0.898

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_S	60_E	2.645	1.00
44_V	65_A	2.465	1.00
39_I	72_A	2.172	1.00
59_E	63_Q	2.090	1.00
33_W	43_H	2.072	1.00
8_F	57_T	2.070	1.00
6_D	57_T	1.984	1.00
83_T	87_Y	1.965	1.00
11_L	47_R	1.895	1.00
21_E	26_L	1.889	1.00
12_V	64_L	1.762	1.00
15_N	18_Q	1.688	1.00
41_G	65_A	1.673	1.00
36_A	39_I	1.666	1.00
31_D	47_R	1.661	1.00
27_A	85_R	1.644	1.00
11_L	26_L	1.569	1.00
60_E	63_Q	1.544	1.00
37_K	81_D	1.538	1.00
9_L	47_R	1.501	1.00
30_N	84_Q	1.482	1.00
66_A	78_V	1.473	1.00
34_L	46_L	1.418	1.00
32_L	84_Q	1.412	1.00
34_L	62_A	1.412	1.00
21_E	25_K	1.405	1.00
12_V	44_V	1.403	1.00
4_S	57_T	1.359	1.00
27_A	45_I	1.326	1.00
10_I	44_V	1.304	1.00
10_I	61_A	1.304	1.00
13_G	19_N	1.301	1.00
37_K	79_P	1.299	1.00
84_Q	87_Y	1.285	1.00
40_P	70_K	1.247	1.00
44_V	64_L	1.225	1.00
63_Q	67_Y	1.221	1.00
46_L	57_T	1.216	1.00
12_V	68_Y	1.177	1.00
32_L	58_L	1.131	1.00
23_T	85_R	1.057	1.00
17_K	21_E	1.043	1.00
11_L	22_L	1.039	1.00
53_E	56_P	1.034	1.00
45_I	85_R	1.017	1.00
14_R	18_Q	1.012	1.00
46_L	61_A	1.009	1.00
4_S	60_E	1.005	1.00
34_L	82_Y	0.981	1.00
4_S	8_F	0.975	1.00
34_L	58_L	0.961	1.00
23_T	88_V	0.960	1.00
72_A	75_S	0.958	1.00
23_T	43_H	0.954	1.00
6_D	54_P	0.932	1.00
29_P	85_R	0.931	1.00
16_A	35_H	0.923	1.00
32_L	82_Y	0.920	1.00
72_A	78_V	0.915	1.00
67_Y	73_R	0.902	1.00
12_V	42_S	0.902	1.00
34_L	61_A	0.893	1.00
83_T	88_V	0.891	1.00
4_S	10_I	0.880	1.00
26_L	47_R	0.842	1.00
39_I	70_K	0.838	1.00
48_T	53_E	0.814	1.00
27_A	33_W	0.814	1.00
28_R	47_R	0.814	1.00
44_V	61_A	0.796	1.00
35_H	43_H	0.790	1.00
24_F	85_R	0.788	1.00
4_S	7_G	0.786	1.00
16_A	20_D	0.783	1.00
32_L	48_T	0.768	1.00
48_T	84_Q	0.762	1.00
5_S	57_T	0.755	1.00
36_A	72_A	0.753	1.00
24_F	88_V	0.749	1.00
48_T	51_G	0.747	1.00
60_E	67_Y	0.746	1.00
54_P	57_T	0.743	1.00
57_T	60_E	0.733	1.00
36_A	69_S	0.730	1.00
52_E	55_P	0.724	1.00
9_L	49_P	0.706	1.00
58_L	82_Y	0.705	1.00
18_Q	21_E	0.703	1.00
66_A	80_V	0.688	1.00
20_D	24_F	0.684	1.00
48_T	54_P	0.669	1.00
23_T	27_A	0.656	1.00
27_A	43_H	0.646	1.00
30_N	86_K	0.645	1.00
42_S	69_S	0.638	1.00
36_A	80_V	0.633	1.00
49_P	52_E	0.630	1.00
20_D	90_K	0.627	1.00
22_L	26_L	0.618	1.00
30_N	48_T	0.596	1.00
20_D	25_K	0.596	1.00
75_S	78_V	0.593	1.00
66_A	79_P	0.590	1.00
59_E	77_K	0.583	1.00
83_T	86_K	0.579	1.00
23_T	33_W	0.577	1.00
10_I	64_L	0.575	1.00
36_A	65_A	0.573	1.00
10_I	60_E	0.570	1.00
51_G	54_P	0.567	1.00
8_F	49_P	0.557	1.00
56_P	59_E	0.552	1.00
6_D	56_P	0.551	1.00
5_S	10_I	0.549	1.00
51_G	55_P	0.547	1.00
48_T	52_E	0.542	1.00
38_G	79_P	0.538	1.00
11_L	18_Q	0.536	1.00
50_G	53_E	0.535	1.00
34_L	80_V	0.532	1.00
87_Y	90_K	0.530	1.00
23_T	26_L	0.527	1.00
28_R	49_P	0.525	1.00
8_F	48_T	0.521	1.00
39_I	75_S	0.514	1.00
62_A	80_V	0.512	1.00
36_A	41_G	0.511	1.00
36_A	70_K	0.510	1.00
29_P	86_K	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2vxtI	1	0.3333	7.8	0.901	Contact Map
3vp6A	2	0.9667	6.7	0.904	Contact Map
1js3A	2	0.9778	6.4	0.905	Contact Map
3abzA	3	0.3889	5.5	0.908	Contact Map
4e1oA	2	0.9778	5.3	0.908	Contact Map
4d0jA	4	0.3222	5.3	0.909	Contact Map
2hmaA	2	0.8889	5	0.91	Contact Map
3k40A	2	0.9556	4.6	0.911	Contact Map
4g1gA	2	0.9889	4.3	0.912	Contact Map
2qmaA	2	0.9667	4.3	0.912	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.