Prolamin_like - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Prolamin_like - Prolamin-like

PFAM:	PF05617	Sequences: KCWSKLTELPGCGLEIFKSIFNGNKTTIGPACCKALVKIGKDCHPAMFKSLGFTPPELKSEILEKSDQLWNYCD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	74 (72)
Sequences:	632 (370)
Seq/√Len:	43.5
META:	0.127

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_I	36_L	3.111	1.00
40_G	70_W	2.422	1.00
34_K	38_K	2.129	1.00
1_K	4_S	2.108	0.99
15_E	29_G	1.976	0.99
41_K	45_P	1.944	0.99
8_E	40_G	1.853	0.99
60_S	67_D	1.736	0.98
20_I	36_L	1.692	0.97
12_C	32_C	1.656	0.97
41_K	70_W	1.617	0.97
31_A	34_K	1.577	0.96
6_L	13_G	1.571	0.96
8_E	26_T	1.534	0.95
48_F	62_I	1.450	0.94
16_I	40_G	1.428	0.93
53_F	59_K	1.367	0.92
8_E	14_L	1.309	0.90
39_I	57_E	1.305	0.90
5_K	40_G	1.278	0.89
19_S	56_P	1.278	0.89
2_C	12_C	1.259	0.88
53_F	56_P	1.238	0.87
1_K	70_W	1.233	0.87
21_F	27_T	1.229	0.87
32_C	43_C	1.229	0.87
7_T	17_F	1.227	0.87
5_K	70_W	1.222	0.86
43_C	73_C	1.217	0.86
2_C	43_C	1.208	0.86
2_C	33_C	1.163	0.84
52_G	55_P	1.157	0.83
8_E	21_F	1.151	0.83
24_N	42_D	1.148	0.83
65_K	69_L	1.132	0.82
33_C	73_C	1.094	0.80
55_P	61_E	1.085	0.79
9_L	40_G	1.070	0.78
58_L	62_I	1.065	0.78
7_T	35_A	1.024	0.75
15_E	35_A	1.019	0.75
28_I	47_M	0.995	0.73
64_E	72_Y	0.995	0.73
13_G	52_G	0.991	0.72
37_V	67_D	0.988	0.72
40_G	48_F	0.985	0.72
8_E	44_H	0.984	0.72
16_I	56_P	0.967	0.71
24_N	41_K	0.959	0.70
38_K	67_D	0.938	0.68
20_I	44_H	0.927	0.67
9_L	20_I	0.919	0.67
6_L	46_A	0.916	0.66
36_L	44_H	0.900	0.65
64_E	67_D	0.898	0.65
8_E	51_L	0.893	0.64
2_C	32_C	0.890	0.64
60_S	64_E	0.887	0.64
9_L	13_G	0.887	0.64
6_L	39_I	0.880	0.63
4_S	49_K	0.878	0.63
8_E	37_V	0.856	0.61
59_K	62_I	0.809	0.57
40_G	51_L	0.787	0.55
13_G	37_V	0.786	0.55
36_L	41_K	0.785	0.54
37_V	40_G	0.783	0.54
16_I	60_S	0.766	0.53
29_G	71_N	0.749	0.51
13_G	17_F	0.729	0.49
41_K	72_Y	0.725	0.49
39_I	42_D	0.717	0.48
24_N	39_I	0.707	0.47
17_F	21_F	0.703	0.47
36_L	40_G	0.696	0.46
25_K	67_D	0.677	0.44
61_E	64_E	0.669	0.43
49_K	70_W	0.668	0.43
9_L	37_V	0.657	0.42
19_S	52_G	0.652	0.42
11_G	55_P	0.637	0.40
7_T	14_L	0.629	0.40
13_G	48_F	0.624	0.39
5_K	31_A	0.616	0.38
47_M	54_T	0.615	0.38
16_I	72_Y	0.611	0.38
31_A	50_S	0.601	0.37
13_G	40_G	0.600	0.37
16_I	55_P	0.594	0.36
10_P	52_G	0.585	0.36
44_H	51_L	0.584	0.36
55_P	62_I	0.568	0.34
22_N	34_K	0.567	0.34
35_A	54_T	0.564	0.34
63_L	66_S	0.563	0.34
27_T	71_N	0.560	0.34
14_L	36_L	0.558	0.33
29_G	66_S	0.555	0.33
30_P	71_N	0.550	0.33
15_E	59_K	0.541	0.32
30_P	62_I	0.539	0.32
11_G	34_K	0.535	0.31
22_N	29_G	0.535	0.31
11_G	31_A	0.530	0.31
10_P	13_G	0.515	0.30
51_L	54_T	0.514	0.30
21_F	26_T	0.506	0.29
56_P	61_E	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2rknA	1	0.9054	7.6	0.868	Contact Map
2malA	1	0.8514	4.3	0.882	Contact Map
1gxsB	1	0.5	4.2	0.883	Contact Map
1siyA	1	0.8514	3.7	0.886	Contact Map
1afhA	1	0.8649	3.6	0.887	Contact Map
1bwoA	1	0.8514	3.6	0.887	Contact Map
2algA	4	0.8514	2.8	0.893	Contact Map
2ln8A	1	0.3378	2.4	0.897	Contact Map
1t12A	1	0.8378	2.1	0.9	Contact Map
1whsB	1	0.473	2	0.901	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.