DUF760 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF760 - Protein of unknown function (DUF760)

PFAM:	PF05542	Sequences: DLLQYVQSLSPETLARLSKPASPEVLEAMERNVQGLLGGLGPSEHFDVTITTSRENLARLLASAMMTGYFLRNAEQRMELERSL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	84 (82)
Sequences:	1080 (560)
Seq/√Len:	61.9
META:	0.515

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_A	32_N	2.707	1.00
22_S	75_E	2.548	1.00
38_G	42_P	2.530	1.00
32_N	63_S	2.411	1.00
72_R	75_E	2.349	1.00
21_A	58_A	2.155	1.00
63_S	67_T	2.115	1.00
49_T	53_S	1.995	1.00
3_L	7_Q	1.988	1.00
40_L	46_F	1.762	0.99
30_E	59_R	1.715	0.99
44_E	48_V	1.675	0.99
40_L	48_V	1.666	0.99
33_V	75_E	1.655	0.99
58_A	62_A	1.604	0.99
72_R	79_E	1.602	0.99
5_Y	8_S	1.560	0.99
26_L	72_R	1.553	0.99
74_A	79_E	1.451	0.98
34_Q	39_G	1.433	0.98
32_N	67_T	1.384	0.97
32_N	64_A	1.382	0.97
43_S	47_D	1.369	0.97
32_N	70_F	1.356	0.97
20_P	52_T	1.322	0.96
62_A	70_F	1.315	0.96
30_E	83_S	1.280	0.95
78_M	82_R	1.255	0.95
12_E	15_A	1.210	0.94
10_S	13_T	1.207	0.94
35_G	62_A	1.188	0.93
77_R	80_L	1.164	0.92
21_A	64_A	1.134	0.91
54_R	57_L	1.100	0.90
79_E	82_R	1.095	0.90
4_Q	8_S	1.088	0.90
77_R	81_E	1.079	0.89
24_E	82_R	1.078	0.89
27_E	48_V	1.076	0.89
67_T	80_L	1.073	0.89
5_Y	12_E	1.073	0.89
9_L	17_L	1.055	0.88
28_A	70_F	1.053	0.88
3_L	6_V	1.053	0.88
13_T	56_N	1.044	0.88
2_L	5_Y	1.008	0.86
6_V	51_T	0.978	0.84
38_G	46_F	0.974	0.84
32_N	73_N	0.973	0.84
42_P	48_V	0.968	0.83
62_A	71_L	0.956	0.83
29_M	45_H	0.948	0.82
33_V	37_L	0.946	0.82
40_L	44_E	0.942	0.82
54_R	60_L	0.936	0.81
43_S	48_V	0.930	0.81
43_S	46_F	0.921	0.80
8_S	17_L	0.906	0.79
32_N	36_L	0.893	0.78
61_L	75_E	0.877	0.77
19_K	52_T	0.866	0.76
71_L	84_L	0.850	0.75
46_F	50_I	0.848	0.74
27_E	39_G	0.836	0.73
6_V	9_L	0.830	0.73
28_A	67_T	0.782	0.68
11_P	15_A	0.779	0.68
36_L	59_R	0.778	0.68
5_Y	14_L	0.767	0.67
8_S	13_T	0.761	0.66
6_V	10_S	0.758	0.66
9_L	75_E	0.746	0.65
17_L	74_A	0.739	0.64
35_G	67_T	0.727	0.63
27_E	80_L	0.726	0.63
6_V	11_P	0.726	0.63
42_P	47_D	0.718	0.62
4_Q	7_Q	0.708	0.61
5_Y	18_S	0.698	0.60
42_P	52_T	0.697	0.59
52_T	74_A	0.693	0.59
6_V	67_T	0.686	0.58
29_M	71_L	0.684	0.58
29_M	74_A	0.684	0.58
5_Y	10_S	0.671	0.57
27_E	30_E	0.651	0.54
71_L	76_Q	0.651	0.54
66_M	70_F	0.645	0.54
69_Y	73_N	0.645	0.54
39_G	83_S	0.640	0.53
56_N	66_M	0.638	0.53
4_Q	48_V	0.637	0.53
62_A	78_M	0.633	0.52
46_F	49_T	0.633	0.52
63_S	70_F	0.628	0.52
70_F	77_R	0.621	0.51
8_S	58_A	0.620	0.51
58_A	66_M	0.610	0.50
40_L	43_S	0.610	0.50
22_S	79_E	0.608	0.49
79_E	83_S	0.598	0.48
21_A	33_V	0.596	0.48
17_L	28_A	0.592	0.48
28_A	79_E	0.591	0.47
25_V	72_R	0.589	0.47
64_A	70_F	0.585	0.47
5_Y	13_T	0.576	0.46
70_F	76_Q	0.574	0.46
17_L	20_P	0.571	0.45
11_P	16_R	0.565	0.44
14_L	18_S	0.564	0.44
61_L	67_T	0.556	0.43
36_L	82_R	0.544	0.42
77_R	83_S	0.541	0.42
3_L	80_L	0.538	0.41
53_S	75_E	0.534	0.41
78_M	81_E	0.524	0.40
54_R	64_A	0.521	0.40
42_P	46_F	0.520	0.40
29_M	66_M	0.516	0.39
38_G	48_V	0.508	0.38
33_V	82_R	0.504	0.38
18_S	78_M	0.500	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ub4A	2	0.4524	10.3	0.889	Contact Map
1cg5B	1	0.7857	9.4	0.891	Contact Map
3bomA	2	0.7976	9.3	0.891	Contact Map
1m1fA	2	0.4524	9.3	0.891	Contact Map
4ebaG	1	0	8.2	0.894	Contact Map
3d1kA	2	0.7976	7.8	0.894	Contact Map
4mzmA	2	0.4881	7.8	0.894	Contact Map
1outA	2	0.7976	7.1	0.896	Contact Map
1spgA	2	0.7976	7	0.897	Contact Map
3w3wA	1	0.6071	6.7	0.898	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.