AzlD - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

AzlD - Branched-chain amino acid transport protein (AzlD)

PFAM:	PF05437	Sequences: IWLAILGMALVTYLTRALGLLLLGRRRLPPRVRRALRYVPPAVLAALVAPALLAPGGALALSLGDARLAAAAVAALVALRRRNLLLTIVAGMAVLALLR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	99 (97)
Sequences:	26115 (16617)
Seq/√Len:	1687.2
META:	0.841

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
73_V	94_V	4.069	1.00
52_L	71_A	3.490	1.00
77_V	90_A	3.293	1.00
83_N	86_L	2.941	1.00
17_A	21_L	2.341	1.00
76_L	80_R	2.278	1.00
13_Y	17_A	2.128	1.00
78_A	87_T	2.001	1.00
77_V	86_L	1.927	1.00
79_L	82_R	1.922	1.00
70_A	94_V	1.785	1.00
41_P	45_A	1.768	1.00
73_V	90_A	1.714	1.00
74_A	91_G	1.707	1.00
33_R	37_R	1.654	1.00
29_P	32_V	1.602	1.00
82_R	86_L	1.586	1.00
31_R	34_R	1.539	1.00
74_A	87_T	1.527	1.00
92_M	96_A	1.525	1.00
70_A	73_V	1.500	1.00
30_P	33_R	1.444	1.00
23_L	26_R	1.438	1.00
75_A	79_L	1.428	1.00
6_L	9_A	1.406	1.00
70_A	95_L	1.394	1.00
64_G	67_R	1.380	1.00
56_G	59_L	1.330	1.00
45_A	49_A	1.326	1.00
3_L	7_G	1.323	1.00
69_A	98_L	1.319	1.00
4_A	8_M	1.318	1.00
30_P	34_R	1.311	1.00
11_V	15_T	1.288	1.00
34_R	38_Y	1.286	1.00
65_D	69_A	1.255	1.00
9_A	13_Y	1.248	1.00
77_V	81_R	1.233	1.00
55_P	58_A	1.202	1.00
77_V	82_R	1.194	1.00
81_R	86_L	1.145	1.00
14_L	18_L	1.127	1.00
76_L	79_L	1.126	1.00
59_L	62_S	1.118	1.00
66_A	98_L	1.114	1.00
93_A	97_L	1.108	1.00
83_N	87_T	1.094	1.00
68_L	72_A	1.084	1.00
70_A	74_A	1.077	1.00
27_R	33_R	1.056	1.00
15_T	18_L	1.020	1.00
39_V	43_V	1.014	1.00
6_L	10_L	1.013	1.00
67_R	95_L	0.992	1.00
2_W	6_L	0.951	1.00
31_R	35_A	0.941	1.00
12_T	15_T	0.923	1.00
55_P	67_R	0.923	1.00
11_V	14_L	0.920	1.00
8_M	11_V	0.911	1.00
42_A	45_A	0.865	1.00
77_V	80_R	0.858	1.00
39_V	42_A	0.847	1.00
94_V	97_L	0.844	1.00
77_V	94_V	0.841	1.00
65_D	68_L	0.836	1.00
53_L	68_L	0.832	1.00
4_A	7_G	0.828	1.00
28_L	31_R	0.819	1.00
23_L	28_L	0.814	1.00
7_G	11_V	0.807	1.00
71_A	74_A	0.805	1.00
18_L	22_L	0.801	1.00
54_A	57_G	0.799	1.00
88_I	95_L	0.791	1.00
94_V	98_L	0.784	1.00
10_L	14_L	0.767	1.00
13_Y	20_L	0.762	1.00
41_P	44_L	0.761	1.00
51_A	55_P	0.753	1.00
26_R	33_R	0.749	1.00
89_V	93_A	0.749	1.00
92_M	95_L	0.725	1.00
86_L	90_A	0.715	1.00
59_L	65_D	0.704	1.00
10_L	13_Y	0.698	1.00
60_A	63_L	0.696	1.00
34_R	37_R	0.669	1.00
40_P	44_L	0.663	1.00
54_A	59_L	0.662	1.00
73_V	98_L	0.662	1.00
30_P	37_R	0.660	1.00
56_G	60_A	0.660	1.00
69_A	72_A	0.660	1.00
66_A	95_L	0.655	1.00
58_A	62_S	0.652	1.00
61_L	65_D	0.652	1.00
49_A	53_L	0.651	1.00
59_L	63_L	0.643	1.00
22_L	25_R	0.643	1.00
55_P	60_A	0.640	1.00
19_G	22_L	0.640	1.00
46_A	50_P	0.639	1.00
88_I	92_M	0.628	1.00
28_L	33_R	0.625	1.00
67_R	71_A	0.624	1.00
57_G	60_A	0.617	1.00
8_M	15_T	0.614	1.00
8_M	12_T	0.614	1.00
5_I	9_A	0.607	1.00
20_L	40_P	0.602	1.00
80_R	83_N	0.601	1.00
72_A	76_L	0.601	1.00
43_V	50_P	0.598	1.00
3_L	6_L	0.591	1.00
32_V	36_L	0.584	1.00
72_A	75_A	0.581	1.00
69_A	94_V	0.577	1.00
66_A	70_A	0.576	1.00
77_V	87_T	0.575	1.00
73_V	76_L	0.570	1.00
60_A	64_G	0.570	1.00
42_A	46_A	0.570	1.00
20_L	23_L	0.569	1.00
91_G	94_V	0.568	1.00
86_L	93_A	0.566	1.00
93_A	96_A	0.563	1.00
60_A	65_D	0.562	1.00
9_A	14_L	0.562	1.00
52_L	68_L	0.560	1.00
90_A	93_A	0.560	1.00
63_L	67_R	0.553	1.00
91_G	95_L	0.544	1.00
55_P	59_L	0.543	1.00
44_L	47_L	0.532	1.00
50_P	71_A	0.527	1.00
15_T	47_L	0.520	1.00
84_L	88_I	0.519	1.00
38_Y	42_A	0.516	1.00
50_P	54_A	0.510	1.00
68_L	71_A	0.507	1.00
77_V	83_N	0.507	1.00
64_G	68_L	0.505	1.00
2_W	5_I	0.504	1.00
27_R	30_P	0.502	1.00
28_L	32_V	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2jlnA	1	0.9192	5.7	0.869	Contact Map
5ajiA	3	0.9192	4.7	0.874	Contact Map
3lb6C	1	0	4.4	0.876	Contact Map
4tllB	2	0.2121	2.9	0.887	Contact Map
2ww9B	1	0.2727	2.8	0.888	Contact Map
3hd6A	3	0.8687	2.8	0.888	Contact Map
3b9wA	3	0.8384	2.6	0.889	Contact Map
2kluA	1	0.3333	2.6	0.889	Contact Map
3mp7B	1	0.2525	2.4	0.891	Contact Map
4hw9A	3	0.9192	2.2	0.894	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.