UMP1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

UMP1 - Proteasome maturation factor UMP1

PFAM:	PF05348	Sequences: PSAPGLHDTLRHGLRSLKSELASSHPLEARLKNWEATQENLKLEMLRRTYGLHAPLRLQMERKIVSQVQRLPGALPSSNLHLDILTGRDETIDFEDVLNDPEESEEMPDPHAEMEKKL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	118 (114)
Sequences:	724 (565)
Seq/√Len:	52.9
META:	0.396

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_E	32_K	3.604	1.00
65_V	81_H	3.566	1.00
27_L	30_R	3.484	1.00
46_L	55_P	3.135	1.00
27_L	31_L	3.057	1.00
80_L	84_I	2.718	1.00
8_D	11_R	2.574	1.00
94_F	98_L	2.441	1.00
70_R	77_S	2.237	1.00
15_R	20_E	2.184	1.00
114_M	118_L	2.059	1.00
66_S	82_L	2.040	1.00
82_L	86_T	2.036	1.00
109_D	112_A	1.992	1.00
39_E	62_R	1.807	0.99
83_D	88_R	1.786	0.99
62_R	82_L	1.752	0.99
70_R	78_S	1.619	0.98
81_H	84_I	1.580	0.98
7_H	12_H	1.571	0.98
24_S	28_E	1.527	0.97
58_L	61_E	1.507	0.97
53_H	57_R	1.497	0.97
99_N	116_K	1.444	0.96
52_L	55_P	1.433	0.96
28_E	95_E	1.405	0.96
114_M	117_K	1.391	0.96
50_Y	54_A	1.384	0.95
115_E	118_L	1.375	0.95
46_L	60_M	1.305	0.94
14_L	49_T	1.291	0.93
43_L	55_P	1.281	0.93
62_R	86_T	1.281	0.93
44_E	48_R	1.254	0.92
27_L	95_E	1.254	0.92
30_R	34_W	1.251	0.92
39_E	43_L	1.231	0.92
52_L	56_L	1.225	0.91
70_R	73_G	1.220	0.91
34_W	37_T	1.187	0.90
92_I	97_V	1.184	0.90
65_V	68_V	1.161	0.89
84_I	89_D	1.146	0.88
47_R	55_P	1.130	0.88
80_L	89_D	1.122	0.87
43_L	62_R	1.121	0.87
14_L	18_K	1.117	0.87
7_H	15_R	1.116	0.87
20_E	33_N	1.092	0.86
4_P	53_H	1.075	0.85
102_E	105_E	1.067	0.84
46_L	58_L	1.050	0.83
17_L	21_L	1.048	0.83
58_L	97_V	1.027	0.82
57_R	60_M	1.021	0.82
77_S	99_N	1.013	0.81
61_E	105_E	1.006	0.81
16_S	53_H	1.004	0.81
9_T	12_H	0.973	0.78
113_E	117_K	0.966	0.78
44_E	57_R	0.959	0.77
60_M	89_D	0.945	0.76
71_L	113_E	0.926	0.75
85_L	89_D	0.925	0.75
100_D	103_E	0.907	0.73
25_H	28_E	0.899	0.73
101_P	105_E	0.890	0.72
79_N	83_D	0.880	0.71
55_P	60_M	0.872	0.70
45_M	49_T	0.862	0.70
64_I	68_V	0.855	0.69
65_V	82_L	0.847	0.68
98_L	101_P	0.842	0.68
79_N	88_R	0.840	0.68
34_W	38_Q	0.835	0.67
63_K	67_Q	0.827	0.66
46_L	87_G	0.821	0.66
64_I	109_D	0.814	0.65
59_Q	93_D	0.804	0.64
88_R	91_T	0.796	0.63
67_Q	78_S	0.791	0.63
46_L	53_H	0.791	0.63
111_H	118_L	0.789	0.63
47_R	85_L	0.783	0.62
53_H	75_L	0.781	0.62
18_K	50_Y	0.777	0.61
83_D	97_V	0.776	0.61
71_L	77_S	0.775	0.61
53_H	62_R	0.773	0.61
95_E	103_E	0.767	0.60
104_S	107_M	0.766	0.60
38_Q	42_K	0.761	0.60
53_H	69_Q	0.758	0.60
56_L	61_E	0.757	0.59
69_Q	81_H	0.741	0.58
86_T	90_E	0.739	0.58
70_R	75_L	0.737	0.57
68_V	72_P	0.736	0.57
49_T	63_K	0.733	0.57
110_P	116_K	0.733	0.57
21_L	54_A	0.729	0.57
27_L	65_V	0.728	0.56
43_L	59_Q	0.726	0.56
25_H	51_G	0.723	0.56
71_L	110_P	0.723	0.56
47_R	52_L	0.719	0.56
73_G	105_E	0.718	0.55
39_E	117_K	0.710	0.55
84_I	91_T	0.708	0.54
92_I	96_D	0.701	0.54
23_S	87_G	0.696	0.53
36_A	40_N	0.692	0.53
38_Q	41_L	0.691	0.53
31_L	37_T	0.681	0.52
42_K	106_E	0.667	0.50
107_M	110_P	0.667	0.50
65_V	85_L	0.666	0.50
24_S	99_N	0.660	0.49
52_L	63_K	0.658	0.49
54_A	57_R	0.652	0.48
6_L	10_L	0.652	0.48
111_H	114_M	0.651	0.48
13_G	82_L	0.651	0.48
31_L	34_W	0.646	0.48
19_S	36_A	0.643	0.48
113_E	118_L	0.635	0.47
5_G	9_T	0.633	0.46
54_A	69_Q	0.625	0.46
14_L	20_E	0.623	0.45
107_M	113_E	0.620	0.45
81_H	110_P	0.616	0.45
30_R	37_T	0.609	0.44
72_P	75_L	0.605	0.44
58_L	94_F	0.600	0.43
45_M	112_A	0.600	0.43
80_L	90_E	0.597	0.43
16_S	20_E	0.597	0.43
24_S	90_E	0.597	0.43
6_L	9_T	0.595	0.43
33_N	114_M	0.589	0.42
104_S	108_P	0.588	0.42
16_S	19_S	0.582	0.41
66_S	114_M	0.578	0.41
94_F	101_P	0.569	0.40
50_Y	105_E	0.568	0.40
59_Q	63_K	0.565	0.39
46_L	49_T	0.565	0.39
100_D	113_E	0.554	0.38
58_L	62_R	0.546	0.38
28_E	39_E	0.545	0.37
89_D	102_E	0.544	0.37
26_P	66_S	0.543	0.37
65_V	87_G	0.542	0.37
21_L	32_K	0.542	0.37
12_H	17_L	0.541	0.37
56_L	99_N	0.534	0.36
5_G	8_D	0.529	0.36
25_H	94_F	0.523	0.35
12_H	77_S	0.523	0.35
105_E	108_P	0.522	0.35
10_L	13_G	0.522	0.35
13_G	65_V	0.522	0.35
31_L	46_L	0.520	0.35
18_K	40_N	0.520	0.35
47_R	65_V	0.519	0.35
36_A	86_T	0.515	0.35
35_E	86_T	0.515	0.35
68_V	81_H	0.512	0.34
101_P	104_S	0.511	0.34
41_L	55_P	0.504	0.34
8_D	12_H	0.500	0.33

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3r07C	1	0.4237	4.4	0.937	Contact Map
2m4iA	1	0.4661	3.7	0.94	Contact Map
2e5aA	1	0.8729	3.3	0.941	Contact Map
3a7rA	1	0.8559	3.1	0.942	Contact Map
2gpvG	1	0.0593	2.9	0.943	Contact Map
1x9bA	1	0.2797	2.7	0.944	Contact Map
2iakA	3	0.5424	2.4	0.945	Contact Map
1v9nA	2	0.6271	2.4	0.945	Contact Map
4wzxE	1	0.1356	2.3	0.945	Contact Map
4ce4c	1	0.6186	2.1	0.947	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.