DUF736 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF736 - Protein of unknown function (DUF736)

PFAM:	PF05284	Sequences: TIGTFTKTGDGFTGTIRTLTLNAKIRIVPNENKDSDNAPDYRVFAGDGVEIGAAWKKTSEEGRDYLSVKLDDPSFPAPIYANLFEAAEDDGGYALIWSRP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	100 (96)
Sequences:	3901 (2038)
Seq/√Len:	208.0
META:	0.839

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
54_A	66_L	4.027	1.00
71_D	99_R	2.863	1.00
27_I	68_V	2.630	1.00
42_R	50_E	2.457	1.00
8_T	11_G	2.249	1.00
33_K	40_D	2.196	1.00
59_S	63_R	2.042	1.00
56_K	64_D	1.877	1.00
69_K	80_Y	1.844	1.00
15_T	24_K	1.840	1.00
58_T	64_D	1.715	1.00
59_S	62_G	1.708	1.00
17_R	22_N	1.670	1.00
40_D	56_K	1.665	1.00
54_A	68_V	1.615	1.00
41_Y	56_K	1.610	1.00
28_V	44_F	1.608	1.00
71_D	78_P	1.578	1.00
15_T	22_N	1.566	1.00
83_L	95_L	1.557	1.00
86_A	94_A	1.538	1.00
86_A	90_D	1.503	1.00
50_E	53_A	1.499	1.00
16_I	25_I	1.475	1.00
84_F	96_I	1.475	1.00
57_K	80_Y	1.464	1.00
35_S	38_A	1.443	1.00
85_E	91_G	1.431	1.00
13_T	26_R	1.401	1.00
82_N	96_I	1.394	1.00
20_T	74_S	1.389	1.00
5_F	83_L	1.346	1.00
57_K	65_Y	1.329	1.00
25_I	51_I	1.327	1.00
69_K	78_P	1.299	1.00
33_K	38_A	1.277	1.00
18_T	72_D	1.238	1.00
93_Y	96_I	1.224	1.00
68_V	81_A	1.203	1.00
72_D	75_F	1.199	1.00
41_Y	66_L	1.190	1.00
56_K	66_L	1.168	1.00
89_D	92_G	1.167	1.00
27_I	43_V	1.144	1.00
12_F	66_L	1.140	1.00
20_T	72_D	1.134	1.00
34_D	38_A	1.109	1.00
6_T	13_T	1.066	1.00
57_K	67_S	1.065	1.00
85_E	93_Y	1.038	1.00
44_F	49_V	1.003	1.00
82_N	98_S	0.993	1.00
44_F	50_E	0.988	1.00
45_A	49_V	0.976	1.00
7_K	11_G	0.975	1.00
68_V	95_L	0.948	0.99
44_F	48_G	0.934	0.99
43_V	68_V	0.929	0.99
63_R	85_E	0.929	0.99
7_K	12_F	0.927	0.99
88_E	92_G	0.926	0.99
5_F	95_L	0.913	0.99
85_E	90_D	0.906	0.99
70_L	79_I	0.904	0.99
8_T	13_T	0.901	0.99
45_A	51_I	0.895	0.99
43_V	70_L	0.882	0.99
86_A	89_D	0.882	0.99
7_K	10_D	0.881	0.99
11_G	29_P	0.874	0.99
30_N	42_R	0.865	0.99
60_E	63_R	0.855	0.99
5_F	25_I	0.855	0.99
15_T	25_I	0.851	0.99
88_E	91_G	0.837	0.99
86_A	92_G	0.834	0.99
35_S	60_E	0.797	0.98
27_I	83_L	0.792	0.98
84_F	94_A	0.782	0.98
59_S	65_Y	0.769	0.98
4_T	7_K	0.761	0.98
53_A	67_S	0.758	0.97
52_G	55_W	0.741	0.97
23_A	45_A	0.733	0.97
66_L	82_N	0.732	0.97
5_F	16_I	0.731	0.97
49_V	74_S	0.719	0.96
27_I	41_Y	0.704	0.96
27_I	54_A	0.678	0.95
36_D	67_S	0.676	0.95
38_A	71_D	0.669	0.95
74_S	79_I	0.668	0.95
18_T	74_S	0.668	0.95
30_N	33_K	0.654	0.94
23_A	51_I	0.639	0.93
21_L	74_S	0.639	0.93
76_P	99_R	0.637	0.93
88_E	94_A	0.635	0.93
26_R	46_G	0.631	0.93
2_I	71_D	0.627	0.93
94_A	98_S	0.626	0.93
28_V	31_E	0.625	0.93
19_L	23_A	0.624	0.93
65_Y	98_S	0.611	0.92
17_R	51_I	0.607	0.92
57_K	82_N	0.598	0.91
38_A	69_K	0.597	0.91
61_E	67_S	0.594	0.91
67_S	80_Y	0.591	0.90
27_I	66_L	0.583	0.90
21_L	49_V	0.582	0.90
30_N	38_A	0.580	0.90
27_I	30_N	0.579	0.90
33_K	41_Y	0.579	0.90
82_N	93_Y	0.577	0.89
7_K	29_P	0.576	0.89
89_D	94_A	0.571	0.89
4_T	8_T	0.567	0.89
64_D	82_N	0.564	0.88
83_L	93_Y	0.564	0.88
71_D	76_P	0.563	0.88
79_I	82_N	0.558	0.88
33_K	36_D	0.557	0.88
80_Y	93_Y	0.557	0.88
71_D	77_A	0.556	0.88
78_P	99_R	0.553	0.87
25_I	43_V	0.541	0.86
55_W	66_L	0.538	0.86
86_A	93_Y	0.536	0.86
84_F	93_Y	0.535	0.86
85_E	94_A	0.532	0.85
24_K	46_G	0.530	0.85
34_D	77_A	0.527	0.85
18_T	21_L	0.527	0.85
40_D	55_W	0.526	0.85
12_F	41_Y	0.514	0.83
18_T	55_W	0.513	0.83
40_D	66_L	0.511	0.83
72_D	99_R	0.511	0.83
50_E	57_K	0.507	0.82
34_D	37_N	0.506	0.82
79_I	97_W	0.506	0.82
21_L	46_G	0.503	0.82
58_T	65_Y	0.500	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2p1wA	1	0.81	7.4	0.917	Contact Map
2qfpA	2	0.35	5.9	0.921	Contact Map
2nqaA	3	0.53	5.8	0.921	Contact Map
2dlgA	1	0.6	5.8	0.921	Contact Map
2r9fA	1	0.53	5.7	0.921	Contact Map
1fyhB	1	0.23	5.7	0.921	Contact Map
3bo6A	1	0.9	4.9	0.924	Contact Map
3kdfD	2	0.66	4.9	0.924	Contact Map
1xzwA	2	0.41	4	0.926	Contact Map
1qxpA	1	0.74	3.7	0.928	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.