BTP - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BTP - Chlorhexidine efflux transporter

PFAM:	PF05232	Sequences: RSLKRRILHAVLFEGGLLLILVPLLAWWLGISLWEALVLDIGLSLFALVWNFVFNWAFDRLFPR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	64 (63)
Sequences:	4515 (2866)
Seq/√Len:	361.1
META:	0.647

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_R	8_L	3.136	1.00
3_L	52_F	3.051	1.00
31_I	36_A	2.260	1.00
52_F	56_W	2.078	1.00
3_L	7_I	1.928	1.00
32_S	35_E	1.917	1.00
10_A	52_F	1.821	1.00
26_A	33_L	1.754	1.00
58_F	63_P	1.744	1.00
18_L	44_S	1.709	1.00
59_D	62_F	1.667	1.00
45_L	49_V	1.618	1.00
31_I	35_E	1.606	1.00
25_L	36_A	1.602	1.00
56_W	60_R	1.519	1.00
53_V	56_W	1.496	1.00
57_A	61_L	1.481	1.00
2_S	5_R	1.443	1.00
47_A	51_N	1.411	1.00
37_L	40_D	1.366	1.00
49_V	53_V	1.205	1.00
53_V	57_A	1.146	1.00
21_L	43_L	1.137	1.00
42_G	46_F	1.126	1.00
3_L	56_W	1.114	1.00
5_R	58_F	1.109	1.00
1_R	47_A	1.099	1.00
4_K	8_L	1.093	1.00
58_F	62_F	1.084	1.00
10_A	48_L	1.075	1.00
23_P	26_A	1.075	1.00
21_L	25_L	1.057	1.00
15_G	19_L	1.016	1.00
4_K	7_I	0.989	1.00
1_R	5_R	0.979	1.00
35_E	38_V	0.947	1.00
41_I	44_S	0.925	1.00
1_R	8_L	0.921	1.00
60_R	63_P	0.896	1.00
44_S	48_L	0.890	1.00
5_R	59_D	0.883	1.00
42_G	45_L	0.877	1.00
19_L	23_P	0.848	1.00
17_L	21_L	0.826	1.00
12_L	15_G	0.819	1.00
21_L	24_L	0.810	1.00
25_L	39_L	0.809	1.00
13_F	17_L	0.803	1.00
20_I	24_L	0.802	1.00
14_E	48_L	0.802	1.00
1_R	59_D	0.781	1.00
27_W	33_L	0.775	1.00
18_L	22_V	0.773	1.00
39_L	55_N	0.767	1.00
16_G	20_I	0.761	1.00
13_F	55_N	0.758	1.00
6_R	56_W	0.754	1.00
50_W	54_F	0.751	1.00
11_V	52_F	0.738	1.00
28_W	55_N	0.732	1.00
24_L	28_W	0.727	1.00
29_L	36_A	0.725	1.00
22_V	36_A	0.724	1.00
41_I	45_L	0.719	0.99
11_V	15_G	0.705	0.99
25_L	29_L	0.703	0.99
39_L	43_L	0.702	0.99
21_L	40_D	0.696	0.99
38_V	42_G	0.666	0.99
12_L	16_G	0.662	0.99
23_P	27_W	0.654	0.99
34_W	38_V	0.643	0.99
40_D	44_S	0.636	0.99
28_W	58_F	0.613	0.98
11_V	48_L	0.606	0.98
44_S	55_N	0.601	0.98
51_N	55_N	0.599	0.98
9_H	54_F	0.596	0.98
43_L	48_L	0.596	0.98
56_W	59_D	0.576	0.98
9_H	23_P	0.570	0.97
59_D	63_P	0.564	0.97
8_L	12_L	0.563	0.97
5_R	25_L	0.562	0.97
57_A	60_R	0.556	0.97
20_I	44_S	0.539	0.96
26_A	29_L	0.538	0.96
2_S	6_R	0.536	0.96
21_L	29_L	0.527	0.96
7_I	11_V	0.513	0.95
29_L	39_L	0.513	0.95
55_N	62_F	0.509	0.95
12_L	19_L	0.501	0.95
10_A	51_N	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4m64A	1	1	9	0.864	Contact Map
4wd8A	3	0.8594	8.7	0.866	Contact Map
3wdoA	1	1	8.5	0.866	Contact Map
2cfqA	1	1	8.5	0.866	Contact Map
4j05A	3	0.9688	8.1	0.867	Contact Map
3o7qA	1	0.9531	5.4	0.877	Contact Map
4ldsA	2	0.9219	5	0.879	Contact Map
3j09A	2	0.9844	4.3	0.884	Contact Map
1pw4A	1	0.9844	4.2	0.884	Contact Map
4pypA	1	0.9688	4.1	0.884	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.