MASE2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MASE2 - MASE2 domain

PFAM:	PF05230	Sequences: RIYRPRVLGLALGFLVVAAVLYERGAPPWLWALLALNALVWPHLAYLLARRSRDPYRAELRNLLLDSALGGAWIALMGFNLLPSVLLLA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	89 (87)
Sequences:	2612 (1877)
Seq/√Len:	201.2
META:	0.822

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
48_L	61_R	3.506	1.00
37_N	73_W	3.195	1.00
74_I	88_L	2.809	1.00
3_Y	43_H	2.739	1.00
3_Y	7_V	2.520	1.00
59_E	62_N	2.401	1.00
46_Y	50_R	2.358	1.00
14_F	39_L	2.336	1.00
58_A	62_N	2.283	1.00
49_A	62_N	1.913	1.00
41_W	45_A	1.830	1.00
37_N	69_L	1.753	1.00
47_L	51_R	1.748	1.00
14_F	38_A	1.736	1.00
75_A	79_F	1.721	1.00
82_L	85_V	1.702	1.00
80_N	83_P	1.675	1.00
54_D	57_R	1.651	1.00
45_A	62_N	1.618	1.00
56_Y	60_L	1.604	1.00
2_I	5_P	1.569	1.00
36_L	40_V	1.544	1.00
21_L	26_A	1.492	1.00
7_V	43_H	1.492	1.00
5_P	8_L	1.425	1.00
28_P	32_A	1.323	1.00
3_Y	46_Y	1.320	1.00
77_M	83_P	1.316	1.00
18_A	31_W	1.309	1.00
48_L	62_N	1.259	1.00
74_I	84_S	1.195	1.00
23_E	26_A	1.180	1.00
20_V	23_E	1.173	1.00
38_A	41_W	1.091	1.00
33_L	72_A	1.061	1.00
14_F	35_A	1.056	1.00
11_A	15_L	1.044	1.00
72_A	76_L	1.026	1.00
52_S	58_A	1.022	1.00
10_L	70_G	1.019	1.00
47_L	50_R	1.016	1.00
77_M	80_N	1.015	1.00
71_G	75_A	0.993	1.00
38_A	73_W	0.973	1.00
21_L	30_L	0.958	0.99
39_L	43_H	0.944	0.99
41_W	80_N	0.937	0.99
2_I	86_L	0.919	0.99
13_G	17_V	0.897	0.99
36_L	44_L	0.888	0.99
58_A	61_R	0.883	0.99
32_A	36_L	0.865	0.99
69_L	72_A	0.862	0.99
61_R	64_L	0.852	0.99
9_G	13_G	0.849	0.99
15_L	19_A	0.843	0.99
10_L	13_G	0.842	0.99
30_L	76_L	0.828	0.98
27_P	30_L	0.821	0.98
8_L	12_L	0.820	0.98
40_V	44_L	0.809	0.98
78_G	81_L	0.791	0.98
18_A	34_L	0.790	0.98
26_A	30_L	0.784	0.98
49_A	59_E	0.783	0.98
67_S	71_G	0.776	0.98
82_L	86_L	0.775	0.98
29_W	32_A	0.774	0.98
5_P	56_Y	0.770	0.97
4_R	9_G	0.763	0.97
20_V	80_N	0.757	0.97
56_Y	61_R	0.756	0.97
70_G	83_P	0.754	0.97
73_W	87_L	0.743	0.97
16_V	22_Y	0.739	0.97
52_S	55_P	0.731	0.96
57_R	61_R	0.729	0.96
18_A	22_Y	0.726	0.96
70_G	87_L	0.711	0.96
49_A	58_A	0.706	0.96
20_V	77_M	0.683	0.95
20_V	82_L	0.682	0.95
44_L	47_L	0.675	0.95
50_R	53_R	0.664	0.94
24_R	53_R	0.659	0.94
13_G	70_G	0.650	0.93
52_S	61_R	0.643	0.93
77_M	87_L	0.631	0.92
9_G	41_W	0.620	0.92
61_R	65_L	0.619	0.92
4_R	7_V	0.618	0.92
10_L	82_L	0.615	0.91
18_A	26_A	0.614	0.91
22_Y	25_G	0.613	0.91
85_V	88_L	0.613	0.91
44_L	61_R	0.609	0.91
11_A	38_A	0.603	0.91
13_G	16_V	0.595	0.90
63_L	66_D	0.589	0.90
75_A	84_S	0.588	0.89
48_L	58_A	0.587	0.89
64_L	68_A	0.584	0.89
41_W	66_D	0.578	0.89
57_R	60_L	0.568	0.88
9_G	55_P	0.566	0.88
10_L	38_A	0.565	0.88
2_I	16_V	0.565	0.88
60_L	63_L	0.562	0.87
37_N	68_A	0.555	0.87
14_F	18_A	0.554	0.86
48_L	51_R	0.551	0.86
24_R	30_L	0.543	0.85
24_R	80_N	0.543	0.85
65_L	69_L	0.543	0.85
17_V	77_M	0.542	0.85
22_Y	40_V	0.540	0.85
12_L	15_L	0.539	0.85
14_F	34_L	0.539	0.85
75_A	78_G	0.537	0.85
77_M	81_L	0.533	0.84
30_L	34_L	0.529	0.84
16_V	24_R	0.521	0.83
41_W	70_G	0.518	0.83
27_P	32_A	0.516	0.82
67_S	79_F	0.515	0.82
70_G	85_V	0.514	0.82
21_L	34_L	0.509	0.82
21_L	25_G	0.508	0.81
33_L	40_V	0.508	0.81
59_E	63_L	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4p6vB	1	0.618	3.7	0.902	Contact Map
1wazA	1	0.3596	2.1	0.914	Contact Map
2xq2A	2	0.5393	1.7	0.918	Contact Map
3j08A	2	0.9775	1.4	0.922	Contact Map
3l1lA	2	0.6404	1.3	0.923	Contact Map
4x5mA	2	0.6517	1.1	0.927	Contact Map
4av3A	2	0.7079	1.1	0.927	Contact Map
4cz8A	2	0.9663	1	0.929	Contact Map
2ws91	3	0.3146	1	0.929	Contact Map
2jllA	1	0.3258	1	0.93	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.