Kri1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Kri1 - KRI1-like family

PFAM:	PF05178	Sequences: ERKEEEKEEKEEELKRLKNLKREEIEEKLEKIKEAAGNDLLGLKELDEEDWADLLEGDFDPEKWDKEMQKLFGDEYYAEEDDDEEKPEWDDDIDIKDIVPDFE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	103 (99)
Sequences:	681 (526)
Seq/√Len:	52.9
META:	0.317

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
63_K	66_K	3.945	1.00
1_E	5_E	3.536	1.00
4_E	8_E	3.213	1.00
12_E	15_K	3.156	1.00
3_K	6_E	3.103	1.00
17_L	20_L	2.764	1.00
5_E	9_E	2.675	1.00
10_K	36_A	2.641	1.00
74_D	77_Y	2.220	1.00
86_K	89_W	2.108	1.00
7_K	11_E	2.048	1.00
67_E	71_L	1.787	0.99
93_I	97_D	1.787	0.99
93_I	98_I	1.736	0.99
57_G	63_K	1.667	0.99
19_N	22_R	1.643	0.98
6_E	9_E	1.624	0.98
67_E	70_K	1.593	0.98
73_G	77_Y	1.533	0.97
8_E	12_E	1.521	0.97
16_R	20_L	1.476	0.97
15_K	22_R	1.475	0.97
73_G	76_Y	1.467	0.97
66_K	70_K	1.436	0.96
21_K	24_E	1.413	0.96
72_F	77_Y	1.340	0.94
59_F	65_D	1.323	0.94
35_A	61_P	1.267	0.93
36_A	72_F	1.213	0.91
19_N	23_E	1.186	0.90
72_F	76_Y	1.172	0.89
8_E	11_E	1.150	0.88
96_K	99_V	1.139	0.88
64_W	72_F	1.139	0.88
86_K	91_D	1.130	0.88
47_D	50_D	1.120	0.87
2_R	6_E	1.116	0.87
29_L	55_L	1.112	0.87
95_I	98_I	1.099	0.86
14_L	19_N	1.097	0.86
14_L	18_K	1.090	0.86
22_R	26_E	1.061	0.84
89_W	92_D	1.050	0.83
5_E	8_E	1.047	0.83
89_W	93_I	1.043	0.83
27_E	30_E	1.031	0.82
29_L	34_E	1.011	0.81
59_F	77_Y	1.011	0.81
27_E	31_K	1.009	0.81
13_E	20_L	0.985	0.79
63_K	67_E	0.974	0.79
30_E	34_E	0.957	0.77
59_F	73_G	0.956	0.77
12_E	19_N	0.953	0.77
4_E	11_E	0.950	0.77
97_D	100_P	0.930	0.75
29_L	54_L	0.922	0.75
94_D	97_D	0.916	0.74
56_E	60_D	0.887	0.72
50_D	55_L	0.878	0.71
1_E	9_E	0.870	0.70
48_E	52_A	0.869	0.70
48_E	55_L	0.864	0.70
70_K	73_G	0.853	0.69
95_I	99_V	0.849	0.68
1_E	42_G	0.846	0.68
30_E	33_K	0.844	0.68
96_K	100_P	0.833	0.67
11_E	89_W	0.833	0.67
13_E	24_E	0.829	0.66
62_E	78_A	0.810	0.65
15_K	19_N	0.809	0.65
47_D	58_D	0.799	0.64
32_I	50_D	0.782	0.62
53_D	59_F	0.771	0.61
61_P	64_W	0.769	0.61
94_D	98_I	0.757	0.59
25_I	61_P	0.749	0.59
31_K	34_E	0.736	0.57
48_E	58_D	0.731	0.57
62_E	66_K	0.723	0.56
48_E	53_D	0.716	0.55
13_E	17_L	0.714	0.55
36_A	43_L	0.704	0.54
40_L	71_L	0.701	0.54
49_E	52_A	0.698	0.53
43_L	46_L	0.698	0.53
18_K	22_R	0.695	0.53
64_W	75_E	0.694	0.53
60_D	63_K	0.690	0.52
4_E	9_E	0.689	0.52
52_A	65_D	0.689	0.52
57_G	67_E	0.688	0.52
72_F	95_I	0.683	0.52
83_D	92_D	0.679	0.51
14_L	67_E	0.674	0.51
88_E	93_I	0.672	0.51
28_K	54_L	0.665	0.50
75_E	78_A	0.663	0.50
91_D	95_I	0.658	0.49
19_N	71_L	0.656	0.49
67_E	73_G	0.655	0.49
15_K	18_K	0.650	0.48
25_I	35_A	0.644	0.48
31_K	67_E	0.637	0.47
32_I	61_P	0.636	0.47
29_L	53_D	0.634	0.47
56_E	74_D	0.622	0.45
10_K	14_L	0.621	0.45
12_E	16_R	0.619	0.45
29_L	92_D	0.619	0.45
19_N	59_F	0.618	0.45
78_A	81_D	0.617	0.45
28_K	68_M	0.610	0.44
28_K	86_K	0.605	0.44
49_E	53_D	0.597	0.43
45_E	53_D	0.578	0.41
24_E	44_K	0.574	0.40
64_W	67_E	0.573	0.40
5_E	11_E	0.565	0.39
4_E	74_D	0.565	0.39
19_N	61_P	0.564	0.39
22_R	61_P	0.561	0.39
29_L	45_E	0.560	0.39
6_E	45_E	0.553	0.38
23_E	67_E	0.545	0.37
48_E	54_L	0.543	0.37
3_K	7_K	0.541	0.37
23_E	27_E	0.540	0.37
81_D	84_E	0.539	0.37
7_K	14_L	0.536	0.37
40_L	78_A	0.534	0.36
27_E	59_F	0.532	0.36
26_E	57_G	0.531	0.36
90_D	95_I	0.530	0.36
24_E	49_E	0.529	0.36
33_K	39_D	0.528	0.36
59_F	63_K	0.523	0.35
48_E	65_D	0.522	0.35
75_E	82_D	0.521	0.35
39_D	43_L	0.512	0.34
18_K	93_I	0.510	0.34
13_E	48_E	0.508	0.34
93_I	96_K	0.508	0.34
24_E	58_D	0.508	0.34
17_L	24_E	0.503	0.33
50_D	75_E	0.500	0.33
12_E	20_L	0.500	0.33

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kblA	2	0	4.4	0.916	Contact Map
3j7yq	1	0	3.7	0.919	Contact Map
3lecA	2	0.3592	3.3	0.921	Contact Map
3kr9A	1	0.3592	3.2	0.921	Contact Map
4m9qA	1	0.1262	3.2	0.921	Contact Map
3psiA	1	0	2.8	0.924	Contact Map
4c92A	1	0.3398	2.6	0.925	Contact Map
3ilwA	2	0.4466	2.2	0.928	Contact Map
4wikA	2	0.5243	2.2	0.928	Contact Map
2inrA	2	0.4854	2.2	0.928	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.