Phage_tail_L - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Phage_tail_L - Phage minor tail protein L

PFAM:	PF05100	Sequences: TAFGGDVLRFHAGTNELGGSIVWQGNTYTPWPIEAEGFEMSGDGTLPRPTLTVSNVDGLITALCLAYDDLVGAKVTRRRTLAKYLDAVNFPGGNPTADPTAEFDEIYYIDRKTSENKEVVEFELASPLDLEGVKLPRRQIIANVCPWCRYRGAECGYTGTPYFDENDNPTTDPALDVCGKRLSSCKLRFGENNPLPFGGFPGAGLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	206 (201)
Sequences:	1482 (1061)
Seq/√Len:	74.8
META:	0.721

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
179_G	184_S	6.756	1.00
164_D	168_N	4.959	1.00
167_D	184_S	4.518	1.00
35_A	38_F	3.968	1.00
34_E	52_T	3.928	1.00
20_S	30_P	3.497	1.00
22_V	27_T	3.283	1.00
9_R	26_N	3.262	1.00
52_T	121_E	3.174	1.00
111_R	123_E	3.058	1.00
98_D	101_A	2.992	1.00
50_T	121_E	2.602	1.00
160_T	163_F	2.534	1.00
78_R	104_D	2.514	1.00
164_D	170_T	2.469	1.00
140_I	203_A	2.342	1.00
181_R	184_S	2.297	1.00
172_D	175_L	2.223	1.00
22_V	88_V	2.207	1.00
69_D	112_K	2.152	1.00
74_K	108_Y	2.128	1.00
52_T	119_V	2.098	1.00
16_E	91_P	2.063	1.00
20_S	27_T	2.062	1.00
24_Q	78_R	2.052	1.00
48_R	123_E	1.953	1.00
60_I	120_V	1.930	1.00
64_C	120_V	1.905	1.00
64_C	122_F	1.875	1.00
165_E	177_V	1.838	1.00
80_T	84_Y	1.805	1.00
38_F	77_R	1.801	1.00
167_D	181_R	1.769	1.00
167_D	179_G	1.690	1.00
133_V	137_R	1.675	1.00
33_I	51_L	1.673	1.00
41_S	47_P	1.661	1.00
152_G	156_G	1.653	1.00
110_D	125_A	1.607	0.99
61_T	65_L	1.580	0.99
170_T	175_L	1.556	0.99
190_G	193_N	1.551	0.99
186_K	191_E	1.535	0.99
146_P	199_G	1.498	0.99
138_R	146_P	1.491	0.99
190_G	195_L	1.471	0.99
36_E	52_T	1.453	0.99
109_I	122_F	1.448	0.99
75_V	109_I	1.446	0.99
184_S	187_L	1.435	0.99
89_N	94_N	1.424	0.99
20_S	29_T	1.393	0.99
112_K	115_E	1.369	0.98
150_Y	188_R	1.338	0.98
193_N	196_P	1.320	0.98
76_T	106_I	1.307	0.98
35_A	51_L	1.301	0.98
23_W	102_E	1.299	0.98
147_W	198_G	1.297	0.98
94_N	97_A	1.274	0.97
78_R	102_E	1.261	0.97
163_F	170_T	1.257	0.97
186_K	192_N	1.247	0.97
182_L	186_K	1.237	0.97
51_L	75_V	1.228	0.97
60_I	122_F	1.225	0.97
184_S	188_R	1.216	0.97
108_Y	127_P	1.204	0.96
74_K	106_I	1.154	0.95
179_G	187_L	1.130	0.95
150_Y	176_D	1.125	0.95
90_F	94_N	1.120	0.94
180_K	184_S	1.111	0.94
190_G	196_P	1.110	0.94
37_G	49_P	1.104	0.94
162_Y	170_T	1.104	0.94
51_L	124_L	1.101	0.94
195_L	201_P	1.093	0.94
197_F	201_P	1.090	0.94
151_R	157_Y	1.082	0.93
14_T	17_L	1.053	0.92
54_S	57_D	1.028	0.91
98_D	103_F	1.013	0.91
183_S	187_L	1.009	0.91
35_A	77_R	1.008	0.91
40_M	105_E	0.994	0.90
182_L	201_P	0.983	0.90
138_R	147_W	0.983	0.90
53_V	60_I	0.982	0.90
156_G	196_P	0.980	0.89
76_T	104_D	0.979	0.89
61_T	115_E	0.970	0.89
24_Q	102_E	0.969	0.89
32_P	108_Y	0.968	0.89
113_T	123_E	0.955	0.88
165_E	168_N	0.952	0.88
23_W	78_R	0.940	0.87
77_R	105_E	0.939	0.87
171_T	175_L	0.936	0.87
163_F	187_L	0.919	0.86
114_S	121_E	0.896	0.85
13_G	18_G	0.896	0.85
178_C	185_C	0.895	0.85
147_W	154_E	0.892	0.84
178_C	188_R	0.886	0.84
185_C	188_R	0.881	0.84
164_D	175_L	0.869	0.83
69_D	81_L	0.866	0.83
8_L	63_L	0.864	0.83
50_T	113_T	0.862	0.82
38_F	107_Y	0.855	0.82
113_T	121_E	0.853	0.82
97_A	101_A	0.853	0.82
21_I	88_V	0.851	0.82
63_L	92_G	0.846	0.81
176_D	188_R	0.843	0.81
15_N	48_R	0.841	0.81
116_N	119_V	0.831	0.80
183_S	186_K	0.817	0.79
12_A	15_N	0.816	0.79
88_V	93_G	0.814	0.79
13_G	48_R	0.810	0.78
49_P	77_R	0.807	0.78
23_W	28_Y	0.793	0.77
72_G	110_D	0.790	0.77
151_R	156_G	0.790	0.77
46_L	128_L	0.785	0.76
87_A	90_F	0.780	0.76
36_E	50_T	0.779	0.76
114_S	119_V	0.775	0.75
79_R	105_E	0.769	0.75
189_F	196_P	0.766	0.74
31_W	54_S	0.765	0.74
110_D	131_E	0.760	0.74
100_T	103_F	0.754	0.73
179_G	188_R	0.754	0.73
161_P	173_P	0.753	0.73
115_E	120_V	0.752	0.73
37_G	50_T	0.743	0.72
86_D	94_N	0.738	0.72
110_D	130_L	0.734	0.71
169_P	172_D	0.733	0.71
138_R	200_F	0.726	0.70
53_V	122_F	0.724	0.70
191_E	194_P	0.714	0.69
20_S	31_W	0.712	0.69
31_W	53_V	0.711	0.69
160_T	170_T	0.697	0.67
178_C	184_S	0.697	0.67
163_F	169_P	0.696	0.67
32_P	56_V	0.695	0.67
65_L	120_V	0.693	0.67
55_N	116_N	0.692	0.67
55_N	61_T	0.692	0.67
59_L	62_A	0.688	0.66
157_Y	176_D	0.688	0.66
196_P	200_F	0.688	0.66
148_C	180_K	0.687	0.66
81_L	129_D	0.687	0.66
61_T	140_I	0.685	0.66
61_T	120_V	0.684	0.66
14_T	19_G	0.683	0.66
65_L	80_T	0.681	0.65
70_L	75_V	0.679	0.65
58_G	116_N	0.678	0.65
97_A	107_Y	0.678	0.65
79_R	83_K	0.676	0.65
177_V	188_R	0.675	0.65
96_T	100_T	0.674	0.65
12_A	152_G	0.671	0.64
69_D	115_E	0.668	0.64
108_Y	130_L	0.666	0.64
25_G	87_A	0.663	0.63
39_E	107_Y	0.663	0.63
128_L	135_L	0.659	0.63
196_P	201_P	0.657	0.63
20_S	68_D	0.654	0.62
63_L	67_Y	0.653	0.62
189_F	193_N	0.651	0.62
41_S	46_L	0.649	0.62
153_A	156_G	0.648	0.62
8_L	161_P	0.647	0.61
146_P	198_G	0.647	0.61
8_L	64_C	0.646	0.61
163_F	168_N	0.641	0.61
75_V	85_L	0.641	0.61
24_Q	99_P	0.640	0.61
16_E	19_G	0.639	0.60
144_V	199_G	0.635	0.60
46_L	126_S	0.635	0.60
83_K	96_T	0.634	0.60
72_G	136_P	0.632	0.60
159_G	162_Y	0.631	0.59
105_E	131_E	0.631	0.59
110_D	139_Q	0.627	0.59
115_E	129_D	0.626	0.59
23_W	90_F	0.626	0.59
11_H	18_G	0.626	0.59
32_P	136_P	0.625	0.59
122_F	127_P	0.622	0.58
67_Y	166_N	0.621	0.58
87_A	94_N	0.616	0.58
141_I	144_V	0.615	0.58
31_W	60_I	0.613	0.57
179_G	183_S	0.611	0.57
47_P	111_R	0.610	0.57
95_P	113_T	0.609	0.57
176_D	184_S	0.609	0.57
115_E	154_E	0.608	0.57
177_V	181_R	0.602	0.56
169_P	173_P	0.601	0.56
160_T	187_L	0.599	0.56
22_V	89_N	0.596	0.55
163_F	167_D	0.595	0.55
11_H	151_R	0.595	0.55
112_K	120_V	0.593	0.55
178_C	181_R	0.593	0.55
93_G	97_A	0.593	0.55
87_A	93_G	0.592	0.55
116_N	121_E	0.591	0.55
12_A	63_L	0.589	0.54
76_T	84_Y	0.589	0.54
81_L	118_E	0.587	0.54
74_K	133_V	0.586	0.54
93_G	98_D	0.585	0.54
90_F	98_D	0.582	0.53
39_E	196_P	0.580	0.53
57_D	109_I	0.580	0.53
93_G	159_G	0.578	0.53
39_E	42_G	0.578	0.53
33_I	111_R	0.578	0.53
43_D	144_V	0.577	0.53
162_Y	172_D	0.577	0.53
129_D	133_V	0.576	0.53
146_P	152_G	0.574	0.52
7_V	76_T	0.574	0.52
180_K	185_C	0.573	0.52
97_A	102_E	0.568	0.52
175_L	188_R	0.568	0.52
182_L	187_L	0.566	0.51
47_P	105_E	0.566	0.51
36_E	119_V	0.565	0.51
81_L	133_V	0.564	0.51
178_C	182_L	0.564	0.51
143_N	180_K	0.563	0.51
47_P	126_S	0.562	0.51
54_S	64_C	0.562	0.51
39_E	47_P	0.562	0.51
177_V	180_K	0.560	0.51
73_A	140_I	0.559	0.51
161_P	170_T	0.558	0.50
148_C	197_F	0.553	0.50
113_T	119_V	0.553	0.50
110_D	142_A	0.553	0.50
186_K	193_N	0.552	0.50
86_D	89_N	0.549	0.49
39_E	115_E	0.548	0.49
51_L	109_I	0.548	0.49
79_R	117_K	0.543	0.49
162_Y	171_T	0.543	0.49
77_R	83_K	0.542	0.48
40_M	61_T	0.541	0.48
86_D	90_F	0.541	0.48
149_R	156_G	0.540	0.48
72_G	79_R	0.540	0.48
19_G	88_V	0.540	0.48
42_G	133_V	0.538	0.48
69_D	79_R	0.535	0.48
154_E	158_T	0.534	0.47
9_R	42_G	0.533	0.47
23_W	80_T	0.533	0.47
171_T	174_A	0.532	0.47
87_A	97_A	0.532	0.47
22_V	26_N	0.531	0.47
110_D	126_S	0.531	0.47
41_S	68_D	0.530	0.47
175_L	192_N	0.528	0.47
60_I	71_V	0.528	0.47
11_H	14_T	0.526	0.46
27_T	53_V	0.526	0.46
70_L	73_A	0.525	0.46
182_L	194_P	0.523	0.46
8_L	18_G	0.520	0.46
70_L	78_R	0.520	0.46
94_N	125_A	0.517	0.45
91_P	140_I	0.516	0.45
105_E	127_P	0.516	0.45
50_T	100_T	0.516	0.45
56_V	68_D	0.516	0.45
31_W	117_K	0.514	0.45
55_N	120_V	0.513	0.45
86_D	121_E	0.511	0.45
105_E	112_K	0.511	0.45
60_I	109_I	0.508	0.44
17_L	21_I	0.507	0.44
97_A	100_T	0.507	0.44
4_G	8_L	0.504	0.44
14_T	33_I	0.503	0.44
186_K	195_L	0.502	0.43
99_P	174_A	0.502	0.43
81_L	103_F	0.501	0.43
22_V	31_W	0.500	0.43

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qiwA	2	0.3932	40.6	0.946	Contact Map
1twfA	1	0.4369	20	0.954	Contact Map
4aybA	1	0.3981	18.1	0.955	Contact Map
3h0gA	2	0.4466	10.1	0.96	Contact Map
2c7hA	1	0.3981	5.2	0.965	Contact Map
4c2mA	1	0.4515	4.9	0.965	Contact Map
4aw7A	1	0.4029	4	0.967	Contact Map
1hqmD	1	0.3155	3.5	0.968	Contact Map
1pmhX	1	0.3495	2.9	0.969	Contact Map
3vnyA	3	0.3107	2.9	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.