DUF669 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF669 - Protein of unknown function (DUF669)

PFAM:	PF05037	Sequences: FNFDASEVESFEPLPAGKYEAVITESEMKPTKGGGPYLKLTFEIRNDLDGEYKGRKVWFDNLNLTNPNPKAVEIARRQLSAICRAVGLPEGTDLVSLPDDSDELHGKPLRVKVKVEKDEDGETYNEVKGYKPAEAAAP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	138 (120)
Sequences:	3450 (2952)
Seq/√Len:	269.5
META:	0.945

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_T	43_E	3.094	1.00
21_A	111_V	3.083	1.00
29_K	39_K	2.864	1.00
116_E	126_E	2.732	1.00
39_K	61_N	2.690	1.00
41_T	56_K	2.497	1.00
25_E	41_T	2.236	1.00
20_E	110_R	2.167	1.00
16_A	115_V	2.104	1.00
18_K	110_R	2.062	1.00
60_D	78_Q	2.028	1.00
26_S	105_H	2.028	1.00
18_K	112_K	1.933	1.00
80_S	84_R	1.926	1.00
36_P	65_T	1.886	1.00
43_E	56_K	1.853	1.00
70_K	73_E	1.850	1.00
20_E	49_D	1.840	1.00
14_L	44_I	1.828	1.00
73_E	77_R	1.721	1.00
37_Y	61_N	1.707	1.00
42_F	109_L	1.667	1.00
114_K	128_K	1.666	1.00
18_K	131_K	1.599	1.00
40_L	62_L	1.564	1.00
30_P	36_P	1.560	1.00
115_V	123_T	1.514	1.00
29_K	37_Y	1.512	1.00
31_T	35_G	1.492	1.00
115_V	125_N	1.482	1.00
21_A	42_F	1.471	1.00
69_P	73_E	1.426	1.00
41_T	59_F	1.410	1.00
57_V	113_V	1.360	1.00
68_N	71_A	1.337	1.00
22_V	43_E	1.327	1.00
23_I	82_I	1.321	1.00
49_D	53_K	1.299	1.00
37_Y	63_N	1.241	1.00
24_T	56_K	1.228	1.00
22_V	48_L	1.224	1.00
21_A	44_I	1.209	1.00
42_F	60_D	1.209	1.00
60_D	130_Y	1.202	1.00
43_E	54_G	1.176	1.00
16_A	114_K	1.173	1.00
118_D	123_T	1.172	1.00
34_G	67_P	1.164	1.00
13_P	115_V	1.155	1.00
56_K	59_F	1.119	1.00
31_T	37_Y	1.114	1.00
66_N	71_A	1.096	1.00
23_I	40_L	1.082	1.00
120_D	123_T	1.075	1.00
26_S	38_L	1.064	1.00
62_L	75_A	1.053	1.00
24_T	41_T	1.052	1.00
63_N	66_N	1.049	1.00
42_F	111_V	1.048	1.00
26_S	40_L	1.044	1.00
31_T	66_N	1.037	1.00
28_M	36_P	1.033	1.00
21_A	109_L	1.030	1.00
118_D	124_Y	1.026	1.00
22_V	108_P	1.023	1.00
71_A	74_I	1.021	1.00
22_V	106_G	1.018	1.00
48_L	108_P	1.012	1.00
23_I	42_F	0.991	1.00
125_N	130_Y	0.958	1.00
117_K	123_T	0.950	1.00
69_P	72_V	0.943	1.00
86_V	109_L	0.942	1.00
52_Y	55_R	0.939	1.00
62_L	82_I	0.927	1.00
14_L	113_V	0.924	1.00
118_D	121_G	0.923	1.00
99_D	103_E	0.921	1.00
80_S	83_C	0.895	1.00
25_E	39_K	0.860	1.00
31_T	34_G	0.852	1.00
38_L	101_S	0.843	1.00
74_I	77_R	0.836	0.99
110_R	131_K	0.832	0.99
121_G	124_Y	0.829	0.99
27_E	39_K	0.828	0.99
81_A	84_R	0.825	0.99
102_D	105_H	0.824	0.99
50_G	53_K	0.824	0.99
65_T	72_V	0.815	0.99
117_K	121_G	0.812	0.99
15_P	52_Y	0.795	0.99
116_E	124_Y	0.795	0.99
13_P	55_R	0.785	0.99
114_K	126_E	0.782	0.99
117_K	122_E	0.776	0.99
71_A	75_A	0.770	0.99
26_S	101_S	0.766	0.99
98_P	103_E	0.765	0.99
100_D	104_L	0.762	0.99
63_N	78_Q	0.753	0.99
20_E	48_L	0.750	0.99
77_R	80_S	0.722	0.99
30_P	33_G	0.722	0.99
66_N	72_V	0.716	0.98
13_P	125_N	0.712	0.98
72_V	76_R	0.711	0.98
35_G	63_N	0.705	0.98
124_Y	130_Y	0.703	0.98
118_D	122_E	0.702	0.98
68_N	74_I	0.702	0.98
72_V	75_A	0.699	0.98
117_K	120_D	0.697	0.98
77_R	81_A	0.693	0.98
70_K	74_I	0.692	0.98
101_S	105_H	0.690	0.98
32_K	37_Y	0.669	0.98
86_V	107_K	0.667	0.98
100_D	103_E	0.658	0.97
35_G	67_P	0.658	0.97
125_N	128_K	0.658	0.97
20_E	108_P	0.656	0.97
91_G	94_L	0.655	0.97
126_E	130_Y	0.654	0.97
82_I	109_L	0.652	0.97
38_L	64_L	0.650	0.97
112_K	131_K	0.649	0.97
28_M	65_T	0.648	0.97
68_N	72_V	0.637	0.97
14_L	55_R	0.635	0.97
102_D	106_G	0.634	0.97
64_L	72_V	0.632	0.97
42_F	127_V	0.626	0.96
94_L	103_E	0.617	0.96
39_K	59_F	0.613	0.96
42_F	62_L	0.611	0.96
109_L	130_Y	0.607	0.96
82_I	86_V	0.603	0.96
40_L	82_I	0.602	0.95
116_E	119_E	0.595	0.95
105_H	108_P	0.594	0.95
12_E	55_R	0.592	0.95
57_V	111_V	0.592	0.95
124_Y	127_V	0.585	0.95
119_E	123_T	0.583	0.95
55_R	59_F	0.582	0.95
8_V	80_S	0.581	0.95
97_L	100_D	0.580	0.95
33_G	37_Y	0.574	0.94
83_C	87_G	0.569	0.94
28_M	64_L	0.569	0.94
44_I	111_V	0.564	0.94
78_Q	81_A	0.563	0.94
101_S	104_L	0.560	0.93
42_F	78_Q	0.552	0.93
16_A	112_K	0.547	0.93
94_L	97_L	0.546	0.93
44_I	50_G	0.543	0.92
42_F	130_Y	0.541	0.92
119_E	122_E	0.539	0.92
96_S	99_D	0.538	0.92
15_P	19_Y	0.538	0.92
76_R	79_L	0.536	0.92
112_K	129_G	0.534	0.92
61_N	126_E	0.530	0.91
64_L	79_L	0.528	0.91
13_P	44_I	0.527	0.91
74_I	78_Q	0.526	0.91
23_I	26_S	0.525	0.91
26_S	104_L	0.524	0.91
115_V	118_D	0.523	0.91
57_V	127_V	0.523	0.91
15_P	44_I	0.515	0.90
63_N	71_A	0.512	0.90
38_L	79_L	0.512	0.90
113_V	125_N	0.508	0.90
40_L	60_D	0.508	0.90
6_S	9_E	0.506	0.89
28_M	38_L	0.503	0.89
76_R	80_S	0.500	0.89

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3v9fA	1	0.3261	33.1	0.89	Contact Map
3ottA	2	0.3986	32.9	0.89	Contact Map
3psiA	1	0	27.9	0.894	Contact Map
4a2lA	4	0.3406	27	0.895	Contact Map
3achA	1	0.4565	26.5	0.895	Contact Map
1uwwA	2	0.4493	22.1	0.899	Contact Map
1pfsA	2	0.2826	14.9	0.907	Contact Map
2x41A	1	0.3333	10.1	0.914	Contact Map
3nqhA	2	0.3333	5.8	0.923	Contact Map
3osvA	2	0.5072	5.5	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.