FtsL - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FtsL - Cell division protein FtsL

PFAM:	PF04999	Sequences: LAKLILRDLWRSGRLNLLLLLAVLASALGVVYSQHQSRQLFVELERLQAERDQLEEEWGRLQLEQSTLASPARIERIARERLGMVPPDPDQVVVVRP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	97 (82)
Sequences:	12673 (8099)
Seq/√Len:	894.4
META:	0.919

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
75_E	79_R	2.883	1.00
77_I	81_R	2.817	1.00
76_R	80_E	2.807	1.00
51_R	55_E	2.364	1.00
58_W	62_Q	2.302	1.00
73_R	77_I	2.207	1.00
47_L	50_E	2.182	1.00
88_D	91_Q	1.999	1.00
36_Q	40_L	1.971	1.00
65_Q	69_A	1.946	1.00
36_Q	39_Q	1.934	1.00
38_R	42_V	1.864	1.00
85_V	91_Q	1.854	1.00
44_L	48_Q	1.774	1.00
57_E	60_R	1.767	1.00
32_Y	36_Q	1.705	1.00
40_L	43_E	1.703	1.00
56_E	59_G	1.689	1.00
48_Q	51_R	1.621	1.00
50_E	53_Q	1.619	1.00
64_E	67_T	1.457	1.00
38_R	41_F	1.420	1.00
37_S	41_F	1.412	1.00
31_V	34_Q	1.337	1.00
29_G	32_Y	1.315	1.00
62_Q	65_Q	1.315	1.00
45_E	48_Q	1.309	1.00
54_L	57_E	1.268	1.00
33_S	37_S	1.257	1.00
55_E	58_W	1.234	1.00
72_A	76_R	1.184	1.00
39_Q	42_V	1.166	1.00
85_V	88_D	1.117	1.00
47_L	51_R	1.114	1.00
35_H	39_Q	1.110	1.00
68_L	73_R	1.107	1.00
39_Q	43_E	1.099	1.00
56_E	60_R	1.046	1.00
52_D	55_E	1.038	1.00
79_R	86_P	1.027	1.00
26_S	30_V	1.014	1.00
30_V	33_S	1.005	1.00
62_Q	66_S	0.994	1.00
29_G	33_S	0.965	1.00
64_E	68_L	0.961	1.00
46_R	50_E	0.947	1.00
53_Q	57_E	0.947	1.00
53_Q	56_E	0.926	1.00
43_E	46_R	0.918	1.00
35_H	38_R	0.901	1.00
63_L	67_T	0.897	1.00
37_S	40_L	0.879	1.00
46_R	49_A	0.873	1.00
22_A	26_S	0.872	1.00
49_A	53_Q	0.858	1.00
34_Q	38_R	0.830	1.00
75_E	86_P	0.825	1.00
51_R	54_L	0.819	1.00
55_E	59_G	0.819	1.00
31_V	35_H	0.818	1.00
79_R	85_V	0.784	1.00
65_Q	68_L	0.780	1.00
27_A	31_V	0.778	1.00
19_L	26_S	0.777	1.00
36_Q	42_V	0.770	1.00
43_E	47_L	0.763	1.00
26_S	33_S	0.762	1.00
41_F	45_E	0.761	1.00
38_R	43_E	0.754	1.00
58_W	65_Q	0.753	1.00
23_V	30_V	0.742	1.00
44_L	47_L	0.730	1.00
30_V	34_Q	0.726	1.00
34_Q	37_S	0.715	1.00
89_P	92_V	0.709	1.00
24_L	28_L	0.707	1.00
21_L	24_L	0.705	1.00
25_A	29_G	0.687	1.00
74_I	78_A	0.685	1.00
69_A	73_R	0.684	1.00
14_R	18_L	0.681	1.00
20_L	30_V	0.669	1.00
49_A	52_D	0.664	1.00
36_Q	41_F	0.659	1.00
60_R	67_T	0.656	1.00
68_L	74_I	0.656	1.00
66_S	69_A	0.648	1.00
15_L	18_L	0.632	1.00
23_V	27_A	0.632	1.00
60_R	64_E	0.629	1.00
45_E	49_A	0.622	1.00
68_L	77_I	0.613	1.00
20_L	61_L	0.613	1.00
36_Q	43_E	0.599	1.00
78_A	84_M	0.599	1.00
74_I	82_L	0.594	1.00
28_L	31_V	0.592	1.00
29_G	34_Q	0.591	1.00
27_A	30_V	0.585	1.00
14_R	17_L	0.584	1.00
87_P	91_Q	0.579	1.00
60_R	63_L	0.570	1.00
35_H	41_F	0.567	1.00
19_L	23_V	0.562	1.00
50_E	54_L	0.559	1.00
18_L	21_L	0.556	1.00
70_S	73_R	0.555	1.00
52_D	56_E	0.550	1.00
17_L	21_L	0.548	1.00
28_L	37_S	0.539	1.00
17_L	22_A	0.537	1.00
69_A	74_I	0.536	1.00
16_N	19_L	0.532	1.00
16_N	20_L	0.521	1.00
59_G	63_L	0.519	1.00
25_A	28_L	0.519	1.00
16_N	24_L	0.516	1.00
72_A	75_E	0.511	1.00
16_N	22_A	0.511	1.00
77_I	80_E	0.508	1.00
48_Q	52_D	0.502	1.00
59_G	62_Q	0.501	1.00
24_L	31_V	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4dznA	3	0.3299	39.1	0.823	Contact Map
2j5uA	4	0.5052	17.9	0.85	Contact Map
2kogA	1	0.3711	14.5	0.856	Contact Map
2oa5A	4	0.5052	13.1	0.859	Contact Map
3u06A	2	0.6701	11.9	0.861	Contact Map
1dipA	2	0.7113	11.8	0.861	Contact Map
3c3gA	2	0.2062	10.3	0.866	Contact Map
4cgkA	3	0.4742	10.3	0.866	Contact Map
1kd8A	1	0.3608	10	0.866	Contact Map
2wq1A	3	0.3299	10	0.866	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.