DivIC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DivIC - Septum formation initiator

PFAM:	PF04977	Sequences: LLLVLVYLLFFGDRGLLAYLRLRREIAELEAELAELEAENARLEAEIERLKSDPDYIEEIAREELGMVKPGETVYIVVDK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	80 (77)
Sequences:	65277 (43103)
Seq/√Len:	4912.0
META:	0.927

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
60_I	64_E	2.598	1.00
33_L	37_E	2.497	1.00
26_I	30_E	2.396	1.00
29_L	32_E	1.808	1.00
58_E	69_K	1.807	1.00
40_N	44_E	1.801	1.00
59_E	63_E	1.689	1.00
36_L	39_E	1.684	1.00
49_R	56_Y	1.645	1.00
20_L	24_R	1.570	1.00
60_I	63_E	1.515	1.00
53_D	56_Y	1.491	1.00
47_I	51_K	1.449	1.00
19_Y	23_R	1.415	1.00
48_E	52_S	1.353	1.00
45_A	49_R	1.345	1.00
6_V	10_F	1.342	1.00
31_A	35_E	1.337	1.00
49_R	53_D	1.308	1.00
16_L	20_L	1.287	1.00
58_E	62_R	1.277	1.00
32_E	35_E	1.259	1.00
25_E	29_L	1.256	1.00
34_A	37_E	1.252	1.00
29_L	33_L	1.249	1.00
39_E	42_R	1.242	1.00
17_L	20_L	1.237	1.00
68_V	74_V	1.231	1.00
17_L	21_R	1.220	1.00
25_E	28_E	1.210	1.00
35_E	39_E	1.208	1.00
13_D	17_L	1.202	1.00
30_E	34_A	1.188	1.00
42_R	46_E	1.187	1.00
37_E	41_A	1.160	1.00
22_L	26_I	1.146	1.00
30_E	33_L	1.146	1.00
34_A	38_A	1.138	1.00
18_A	22_L	1.125	1.00
22_L	25_E	1.101	1.00
18_A	21_R	1.096	1.00
28_E	32_E	1.092	1.00
23_R	27_A	1.084	1.00
56_Y	60_I	1.079	1.00
62_R	72_E	1.073	1.00
38_A	42_R	1.044	1.00
43_L	46_E	1.040	1.00
74_V	78_V	1.031	1.00
32_E	36_L	1.028	1.00
20_L	23_R	1.006	1.00
44_E	48_E	1.000	1.00
27_A	30_E	0.994	1.00
56_Y	59_E	0.966	1.00
23_R	26_I	0.956	1.00
24_R	28_E	0.949	1.00
39_E	43_L	0.948	1.00
26_I	29_L	0.920	1.00
33_L	40_N	0.920	1.00
5_L	8_L	0.916	1.00
31_A	34_A	0.911	1.00
36_L	40_N	0.905	1.00
73_T	76_I	0.903	1.00
27_A	31_A	0.878	1.00
19_Y	22_L	0.877	1.00
37_E	40_N	0.876	1.00
33_L	36_L	0.869	1.00
40_N	43_L	0.863	1.00
13_D	16_L	0.862	1.00
38_A	41_A	0.843	1.00
28_E	31_A	0.829	1.00
12_G	15_G	0.819	1.00
43_L	47_I	0.817	1.00
40_N	47_I	0.793	1.00
15_G	18_A	0.788	1.00
4_V	8_L	0.765	1.00
69_K	72_E	0.756	1.00
44_E	47_I	0.755	1.00
61_A	67_M	0.742	1.00
41_A	45_A	0.728	1.00
46_E	49_R	0.723	1.00
41_A	44_E	0.720	1.00
21_R	25_E	0.712	1.00
45_A	48_E	0.708	1.00
15_G	19_Y	0.701	1.00
57_I	61_A	0.694	1.00
46_E	56_Y	0.683	1.00
7_Y	12_G	0.680	1.00
47_I	50_L	0.679	1.00
35_E	38_A	0.674	1.00
3_L	7_Y	0.668	1.00
9_L	13_D	0.662	1.00
14_R	18_A	0.662	1.00
24_R	27_A	0.650	1.00
62_R	69_K	0.637	1.00
61_A	65_L	0.633	1.00
7_Y	11_F	0.631	1.00
55_D	58_E	0.625	1.00
26_I	33_L	0.624	1.00
60_I	65_L	0.624	1.00
46_E	50_L	0.621	1.00
10_F	13_D	0.601	1.00
54_P	57_I	0.598	1.00
47_I	52_S	0.597	1.00
11_F	14_R	0.591	1.00
68_V	73_T	0.590	1.00
50_L	56_Y	0.581	1.00
73_T	77_V	0.573	1.00
12_G	16_L	0.572	1.00
48_E	51_K	0.543	1.00
7_Y	10_F	0.536	1.00
73_T	78_V	0.536	1.00
54_P	58_E	0.528	1.00
5_L	9_L	0.527	1.00
8_L	13_D	0.524	1.00
6_V	9_L	0.503	1.00
11_F	15_G	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4dznA	3	0.4	48.8	0.755	Contact Map
4iffA	2	0.6375	46.5	0.758	Contact Map
4cgkA	3	0.5875	34.6	0.776	Contact Map
2zqmA	5	0.7625	28.5	0.785	Contact Map
1fxkA	2	0.7	20.7	0.798	Contact Map
3rvyA	3	0.2	17.8	0.804	Contact Map
4cbcA	3	0.2	17.7	0.805	Contact Map
4etpA	1	0.7625	17.2	0.806	Contact Map
4etpB	1	0.75	16.2	0.808	Contact Map
1a93B	1	0.4	15.8	0.81	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.