HupE_UreJ - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HupE_UreJ - HupE / UreJ protein

PFAM:	PF04955	Sequences: LALLLLPAPALAHTGHGGAGGFLSGFEHPLTGLDHLLFMLAVGLLAAQLGGRALWLLPTAFTLAMLAGAALGLLGVPLPGVEPGIALSIVVLGLLVALARRLPLAAAAALVFLFGLFHGFAHGGELPEAGLPLLFNLGFELGQLLLHAAGIALGLLLRRRAGRAVRVAGAAIAAAGLAL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	179 (174)
Sequences:	12850 (9094)
Seq/√Len:	689.4
META:	0.891

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
66_L	140_E	3.164	1.00
65_M	68_G	3.111	1.00
52_R	56_L	2.864	1.00
80_G	83_P	2.676	1.00
27_E	31_T	2.372	1.00
129_A	132_P	2.346	1.00
120_F	124_G	2.200	1.00
62_T	144_L	2.182	1.00
84_G	117_F	2.177	1.00
129_A	133_L	2.134	1.00
69_A	72_G	2.115	1.00
41_A	172_I	2.082	1.00
55_W	58_P	2.057	1.00
62_T	140_E	2.029	1.00
57_L	111_V	1.979	1.00
85_I	121_A	1.902	1.00
69_A	73_L	1.901	1.00
160_R	163_R	1.874	1.00
26_F	142_G	1.817	1.00
135_F	139_F	1.806	1.00
58_P	61_F	1.804	1.00
64_A	112_F	1.775	1.00
41_A	92_L	1.762	1.00
42_V	111_V	1.755	1.00
146_L	150_G	1.746	1.00
88_S	118_H	1.695	1.00
45_L	107_A	1.692	1.00
81_V	120_F	1.661	1.00
136_N	140_E	1.656	1.00
152_A	156_L	1.588	1.00
36_L	146_L	1.584	1.00
53_A	56_L	1.532	1.00
143_Q	147_H	1.501	1.00
166_R	169_G	1.489	1.00
59_T	63_L	1.482	1.00
24_S	27_E	1.458	1.00
155_L	158_R	1.450	1.00
130_G	134_L	1.447	1.00
155_L	159_R	1.421	1.00
164_A	167_V	1.404	1.00
156_L	159_R	1.403	1.00
8_A	11_L	1.388	1.00
136_N	139_F	1.385	1.00
170_A	173_A	1.385	1.00
58_P	62_T	1.380	1.00
23_L	27_E	1.377	1.00
64_A	67_A	1.376	1.00
15_G	18_G	1.373	1.00
60_A	112_F	1.367	1.00
109_A	113_L	1.360	1.00
169_G	172_I	1.359	1.00
156_L	160_R	1.355	1.00
37_L	175_A	1.340	1.00
167_V	170_A	1.334	1.00
168_A	171_A	1.319	1.00
16_H	20_G	1.307	1.00
59_T	62_T	1.281	1.00
14_T	18_G	1.275	1.00
152_A	155_L	1.270	1.00
62_T	65_M	1.268	1.00
61_F	115_G	1.267	1.00
130_G	133_L	1.263	1.00
56_L	108_A	1.261	1.00
135_F	140_E	1.255	1.00
103_P	106_A	1.251	1.00
140_E	143_Q	1.251	1.00
94_L	98_L	1.247	1.00
69_A	139_F	1.233	1.00
37_L	89_I	1.230	1.00
167_V	171_A	1.230	1.00
83_P	86_A	1.203	1.00
95_L	100_R	1.194	1.00
171_A	174_A	1.191	1.00
165_V	169_G	1.168	1.00
39_M	139_F	1.156	1.00
63_L	67_A	1.153	1.00
14_T	17_G	1.149	1.00
70_A	74_L	1.144	1.00
102_L	106_A	1.135	1.00
72_G	75_G	1.133	1.00
151_I	154_G	1.130	1.00
148_A	152_A	1.130	1.00
64_A	115_G	1.124	1.00
140_E	144_L	1.113	1.00
64_A	68_G	1.099	1.00
125_E	128_E	1.086	1.00
60_A	108_A	1.080	1.00
52_R	55_W	1.063	1.00
74_L	77_P	1.061	1.00
65_M	143_Q	1.059	1.00
60_A	64_A	1.045	1.00
165_V	168_A	1.045	1.00
61_F	65_M	1.041	1.00
71_L	116_L	1.032	1.00
144_L	148_A	1.028	1.00
44_L	165_V	1.015	1.00
159_R	162_G	1.014	1.00
30_L	145_L	1.013	1.00
11_L	15_G	1.005	1.00
145_L	149_A	1.005	1.00
135_F	143_Q	0.990	1.00
30_L	142_G	0.980	1.00
39_M	143_Q	0.969	1.00
98_L	101_R	0.966	1.00
7_P	11_L	0.962	1.00
41_A	93_G	0.958	1.00
127_P	130_G	0.950	1.00
171_A	175_A	0.940	1.00
57_L	61_F	0.930	1.00
55_W	61_F	0.930	1.00
105_A	108_A	0.927	1.00
158_R	163_R	0.922	1.00
115_G	122_H	0.903	1.00
44_L	96_V	0.902	1.00
103_P	107_A	0.901	1.00
147_H	151_I	0.896	1.00
168_A	172_I	0.892	1.00
87_L	90_V	0.876	1.00
101_R	104_L	0.868	1.00
148_A	151_I	0.866	1.00
50_G	53_A	0.866	1.00
21_G	24_S	0.862	1.00
57_L	107_A	0.861	1.00
26_F	29_P	0.857	1.00
154_G	157_L	0.855	1.00
36_L	40_L	0.843	1.00
158_R	161_A	0.841	1.00
53_A	57_L	0.840	1.00
35_H	118_H	0.837	1.00
129_A	134_L	0.831	1.00
85_I	88_S	0.829	1.00
81_V	84_G	0.817	1.00
71_L	76_V	0.816	1.00
72_G	120_F	0.816	1.00
154_G	158_R	0.815	1.00
127_P	133_L	0.812	1.00
69_A	136_N	0.807	1.00
131_L	134_L	0.803	1.00
77_P	80_G	0.801	1.00
139_F	143_Q	0.792	1.00
65_M	69_A	0.792	1.00
164_A	168_A	0.789	1.00
136_N	143_Q	0.780	1.00
46_A	57_L	0.779	1.00
94_L	97_A	0.777	1.00
32_G	35_H	0.773	1.00
26_F	145_L	0.771	1.00
56_L	59_T	0.771	1.00
50_G	54_L	0.770	1.00
95_L	98_L	0.768	1.00
122_H	139_F	0.766	1.00
166_R	170_A	0.760	1.00
157_L	161_A	0.759	1.00
54_L	151_I	0.756	1.00
164_A	169_G	0.753	1.00
51_G	54_L	0.746	1.00
153_L	157_L	0.742	1.00
151_I	155_L	0.736	1.00
40_L	146_L	0.731	1.00
147_H	150_G	0.728	1.00
170_A	174_A	0.726	1.00
149_A	152_A	0.726	1.00
82_E	85_I	0.723	1.00
39_M	147_H	0.721	1.00
22_F	137_L	0.719	1.00
49_L	57_L	0.716	1.00
61_F	64_A	0.705	1.00
126_L	136_N	0.699	1.00
77_P	120_F	0.693	1.00
87_L	91_V	0.689	1.00
15_G	27_E	0.688	1.00
15_G	19_A	0.684	1.00
64_A	116_L	0.681	1.00
118_H	122_H	0.679	1.00
16_H	19_A	0.678	1.00
142_G	145_L	0.677	1.00
86_A	93_G	0.675	1.00
17_G	20_G	0.673	1.00
31_T	125_E	0.673	1.00
6_L	9_P	0.671	1.00
29_P	142_G	0.666	1.00
41_A	45_L	0.663	1.00
158_R	162_G	0.662	1.00
75_G	78_L	0.659	1.00
122_H	125_E	0.659	1.00
24_S	31_T	0.656	1.00
43_G	46_A	0.653	1.00
54_L	58_P	0.653	1.00
139_F	142_G	0.653	1.00
66_L	69_A	0.650	1.00
106_A	109_A	0.649	1.00
22_F	26_F	0.646	1.00
68_G	72_G	0.644	1.00
27_E	30_L	0.644	1.00
91_V	95_L	0.642	1.00
104_L	107_A	0.639	1.00
128_E	131_L	0.635	1.00
32_G	118_H	0.635	1.00
47_A	154_G	0.634	1.00
96_V	169_G	0.634	1.00
157_L	160_R	0.631	1.00
11_L	14_T	0.630	1.00
126_L	135_F	0.628	1.00
23_L	26_F	0.627	1.00
81_V	121_A	0.627	1.00
38_F	92_L	0.623	1.00
24_S	129_A	0.618	1.00
99_A	102_L	0.617	1.00
169_G	173_A	0.617	1.00
126_L	130_G	0.613	1.00
156_L	161_A	0.610	1.00
170_A	177_L	0.609	1.00
104_L	108_A	0.603	1.00
37_L	48_Q	0.600	1.00
174_A	177_L	0.600	1.00
144_L	147_H	0.597	1.00
28_H	35_H	0.596	1.00
34_D	82_E	0.595	1.00
169_G	176_G	0.593	1.00
98_L	103_P	0.593	1.00
139_F	147_H	0.593	1.00
97_A	100_R	0.593	1.00
73_L	132_P	0.593	1.00
49_L	53_A	0.592	1.00
40_L	150_G	0.591	1.00
22_F	141_L	0.590	1.00
34_D	38_F	0.581	1.00
172_I	175_A	0.580	1.00
90_V	176_G	0.579	1.00
43_G	154_G	0.578	1.00
14_T	19_A	0.576	1.00
83_P	87_L	0.576	1.00
165_V	170_A	0.574	1.00
143_Q	150_G	0.573	1.00
80_G	84_G	0.570	1.00
145_L	148_A	0.563	1.00
127_P	135_F	0.562	1.00
39_M	42_V	0.560	1.00
113_L	117_F	0.554	1.00
43_G	47_A	0.551	1.00
60_A	63_L	0.551	1.00
55_W	62_T	0.551	1.00
159_R	163_R	0.551	1.00
53_A	58_P	0.548	1.00
96_V	99_A	0.548	1.00
14_T	20_G	0.542	1.00
98_L	102_L	0.542	1.00
9_P	14_T	0.537	1.00
150_G	154_G	0.535	1.00
95_L	99_A	0.532	1.00
102_L	107_A	0.530	1.00
38_F	114_F	0.528	1.00
26_F	30_L	0.527	1.00
92_L	95_L	0.523	1.00
4_L	7_P	0.518	0.99
37_L	41_A	0.517	0.99
72_G	77_P	0.512	0.99
19_A	23_L	0.507	0.99
72_G	123_G	0.505	0.99
108_A	112_F	0.502	0.99
125_E	129_A	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2l2tA	2	0.2458	5.6	0.933	Contact Map
4cz8A	2	0.8156	4.9	0.936	Contact Map
4ldsA	2	0.4134	3.6	0.939	Contact Map
2jwaA	2	0.2458	3.3	0.94	Contact Map
4gc0A	1	0.4525	3	0.942	Contact Map
2ks1B	1	0.2402	2.7	0.943	Contact Map
2nq2A	2	0.6145	2.7	0.943	Contact Map
4czbA	2	0.8212	2.3	0.946	Contact Map
4bwzA	2	0.514	2.1	0.947	Contact Map
2qi9A	2	0.6872	1.9	0.947	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.